| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa025091m |
| Family | GH19 |
| Protein Properties | Length: 122 Molecular Weight: 13262 Isoelectric Point: 8.2038 |
| Chromosome | Chromosome/Scaffold: 4 Start: 21280613 End: 21280978 |
| Description | basic chitinase |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH19 | 1 | 113 | 0 |
| NYNYGQCGKAIGADLLNNPDLVATDPVISFKTALWFWMTPQSPKPSCHDVITRRWNPSGADKSTGQVPHYGVTTNIINGGLECGKSWNAKVEERIGFYKR YCDLVGVGYGNNC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 122 Download |
| NYNYGQCGKA IGADLLNNPD LVATDPVISF KTALWFWMTP QSPKPSCHDV ITRRWNPSGA 60 DKSTGQVPHY GVTTNIINGG LECGKSWNAK VEERIGFYKR YCDLVGVGYG NNCHTPGLAL 120 L* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00442 | lysozyme_like | 3.0e-5 | 1 | 77 | 77 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
| COG3179 | COG3179 | 2.0e-6 | 3 | 81 | 79 | + Predicted chitinase [General function prediction only] | ||
| cd00325 | chitinase_glyco_hydro_19 | 1.0e-66 | 1 | 112 | 112 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
| pfam00182 | Glyco_hydro_19 | 3.0e-69 | 1 | 112 | 112 | + Chitinase class I. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004568 | chitinase activity |
| GO:0006032 | chitin catabolic process |
| GO:0016998 | cell wall macromolecule catabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK96628.1 | 0 | 1 | 112 | 187 | 298 | unknown [Populus trichocarpa x Populus deltoides] |
| RefSeq | XP_002306220.1 | 0 | 1 | 112 | 190 | 301 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002312918.1 | 0 | 1 | 112 | 112 | 223 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002312919.1 | 0 | 1 | 112 | 108 | 219 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002312923.1 | 0 | 1 | 112 | 187 | 298 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4dyg_B | 0 | 1 | 112 | 123 | 234 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 4dyg_A | 0 | 1 | 112 | 123 | 234 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 4dwx_B | 0 | 1 | 112 | 123 | 234 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |
| PDB | 4dwx_A | 0 | 1 | 112 | 123 | 234 | A Chain A, Crystal Structure Of A Family Gh-19 Chitinase From Rye Seeds |
| PDB | 3cql_B | 0 | 1 | 112 | 122 | 233 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EL897801 | 112 | 1 | 112 | 0 |
| FL482801 | 112 | 1 | 112 | 0 |
| FR627808 | 112 | 1 | 112 | 0 |
| FL483148 | 112 | 1 | 112 | 0 |
| GE299546 | 112 | 1 | 112 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
