| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa025274m |
| Family | GT51 |
| Protein Properties | Length: 145 Molecular Weight: 16218.2 Isoelectric Point: 9.6888 |
| Chromosome | Chromosome/Scaffold: 1 Start: 40567558 End: 40569398 |
| Description | |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT51 | 5 | 111 | 5.3e-37 |
| KLVKNTFLKNERTLSRKMVEMVMSLALEKTMLKGQILSCYISKIYWGHGIYGVESASTFYFGKHPSCLSLGESAMLAGLIPAPELRSPLRDPSRGKTFQA RVLKRMV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 145 Download |
| MDVGKLVKNT FLKNERTLSR KMVEMVMSLA LEKTMLKGQI LSCYISKIYW GHGIYGVESA 60 STFYFGKHPS CLSLGESAML AGLIPAPELR SPLRDPSRGK TFQARVLKRM VDVGFLDFET 120 ALFVVKQYLP LHVTESEAPV VFLLG |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK11636 | mrcA | 2.0e-23 | 5 | 116 | 112 | + penicillin-binding protein 1a; Provisional | ||
| COG5009 | MrcA | 3.0e-33 | 6 | 142 | 137 | + Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane] | ||
| COG0744 | MrcB | 1.0e-38 | 5 | 121 | 117 | + Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] | ||
| TIGR02074 | PBP_1a_fam | 6.0e-41 | 6 | 121 | 116 | + penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]. | ||
| pfam00912 | Transgly | 4.0e-45 | 6 | 111 | 106 | + Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerisation of murein glycan chains. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003824 | catalytic activity |
| GO:0009252 | peptidoglycan biosynthetic process |
| GO:0009274 | peptidoglycan-based cell wall |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAE45868.1 | 2.00386e-43 | 5 | 131 | 253 | 379 | penicillin-binding protein [Physcomitrella patens] |
| EMBL | CAN72729.1 | 3e-38 | 46 | 129 | 951 | 1034 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI19051.1 | 0 | 5 | 129 | 172 | 296 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_001771453.1 | 9.94922e-44 | 5 | 131 | 253 | 379 | penicillin-binding protein [Physcomitrella patens subsp. patens] |
| RefSeq | YP_003317570.1 | 1e-30 | 5 | 144 | 135 | 282 | penicillin-binding protein, 1A family [Thermanaerovibrio acidaminovorans DSM 6589] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3nb7_A | 2e-20 | 5 | 116 | 78 | 189 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
| PDB | 3d3h_A | 2e-20 | 5 | 116 | 78 | 189 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
| PDB | 2oqo_A | 2e-20 | 5 | 116 | 78 | 189 | A Chain A, Crystal Structure Of A Peptidoglycan Glycosyltransferase From A Class A Pbp: Insight Into Bacterial Cell Wall Synthesis |
| PDB | 3nb6_A | 2e-20 | 5 | 116 | 78 | 189 | A Chain A, Crystal Structure Of Aquifex Aeolicus Peptidoglycan Glycosyltransferase In Complex With Methylphosphoryl Neryl Moenomycin |
| PDB | 3ue1_B | 5e-19 | 5 | 116 | 97 | 208 | A Chain A, Crystal Structure Of Aquifex Aeolicus Peptidoglycan Glycosyltransferase In Complex With Methylphosphoryl Neryl Moenomycin |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EC926211 | 125 | 5 | 129 | 0 |
| DT557994 | 129 | 5 | 133 | 0 |
| EX301431 | 119 | 5 | 123 | 1.96182e-44 |
| DR917962 | 105 | 5 | 109 | 2e-40 |
| DR917962 | 35 | 98 | 132 | 0.000004 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |