Basic Information | |
---|---|
Species | Prunus persica |
Cazyme ID | ppa025411m |
Family | GT1 |
Protein Properties | Length: 141 Molecular Weight: 15925.1 Isoelectric Point: 4.6053 |
Chromosome | Chromosome/Scaffold: 6 Start: 19255869 End: 19256291 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 6 | 127 | 2.3e-22 |
YIALGSELNLSQEDFTELALGLELSGLPFFWVLRTPSWSADSDSVKLPDGFEERTKGRGLVWTTWAPQTKILAHDSIGGFLTHCSWSSLIEALQYGRPLI MLPFLYDQGLIARFWDKKIGIE |
Full Sequence |
---|
Protein Sequence Length: 141 Download |
EWNCVYIALG SELNLSQEDF TELALGLELS GLPFFWVLRT PSWSADSDSV KLPDGFEERT 60 KGRGLVWTTW APQTKILAHD SIGGFLTHCS WSSLIEALQY GRPLIMLPFL YDQGLIARFW 120 DKKIGIEVPR NEEDGSFTRK * |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
PLN02992 | PLN02992 | 2.0e-31 | 5 | 139 | 149 | + coniferyl-alcohol glucosyltransferase |
PLN02534 | PLN02534 | 2.0e-31 | 5 | 130 | 126 | + UDP-glycosyltransferase |
PLN00164 | PLN00164 | 3.0e-33 | 5 | 117 | 120 | + glucosyltransferase; Provisional |
PLN03015 | PLN03015 | 2.0e-35 | 1 | 132 | 139 | + UDP-glucosyl transferase |
PLN02670 | PLN02670 | 3.0e-55 | 5 | 138 | 135 | + transferase, transferring glycosyl groups |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAU09445.1 | 0 | 3 | 140 | 286 | 424 | putative UDP-rhamnose:rhamnosyltransferase [Fragaria x ananassa] |
RefSeq | XP_002297733.1 | 0 | 3 | 139 | 274 | 411 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002315125.1 | 0 | 3 | 140 | 282 | 415 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002325254.1 | 0 | 3 | 139 | 271 | 408 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002533517.1 | 0 | 3 | 138 | 272 | 408 | UDP-glucosyltransferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2vg8_A | 1e-26 | 3 | 140 | 269 | 417 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 2vch_A | 1e-26 | 3 | 140 | 269 | 417 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
PDB | 2vce_A | 1e-26 | 3 | 140 | 269 | 417 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2c9z_A | 2e-24 | 3 | 139 | 272 | 399 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2c1z_A | 2e-24 | 3 | 139 | 272 | 399 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FP059882 | 138 | 3 | 139 | 0 |
AJ778656 | 139 | 3 | 140 | 0 |
DT484070 | 141 | 1 | 140 | 0 |
FG195772 | 137 | 3 | 138 | 0 |
DT482781 | 139 | 3 | 140 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |