| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa026632m |
| Family | GH1 |
| Protein Properties | Length: 104 Molecular Weight: 12214.8 Isoelectric Point: 6.3379 |
| Chromosome | Chromosome/Scaffold: 3 Start: 8334426 End: 8334831 |
| Description | beta glucosidase 15 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 11 | 102 | 5.2e-29 |
| MNVILVYIAGMDEFNNPKLSLKQALDDANRIDYYYRHLCYLQAAIKEGANVQGYFAWSLLDNFEWRDGYTIWFGINYIDYHNGLERHSKLST | |||
| Full Sequence |
|---|
| Protein Sequence Length: 104 Download |
| HIFSLDKEKC MNVILVYIAG MDEFNNPKLS LKQALDDANR IDYYYRHLCY LQAAIKEGAN 60 VQGYFAWSLL DNFEWRDGYT IWFGINYIDY HNGLERHSKL STH* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR01233 | lacG | 2.0e-12 | 32 | 90 | 59 | + 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| PRK13511 | PRK13511 | 1.0e-14 | 35 | 103 | 69 | + 6-phospho-beta-galactosidase; Provisional | ||
| COG2723 | BglB | 2.0e-18 | 36 | 101 | 66 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam00232 | Glyco_hydro_1 | 7.0e-21 | 34 | 101 | 68 | + Glycosyl hydrolase family 1. | ||
| TIGR03356 | BGL | 1.0e-22 | 36 | 103 | 68 | + beta-galactosidase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAA93032.1 | 0 | 7 | 103 | 419 | 516 | prunasin hydrolase isoform PH I precursor [Prunus serotina] |
| GenBank | AAF34651.2 | 9.80909e-45 | 8 | 103 | 414 | 511 | AF221527_1 putative prunasin hydrolase isoform PH-L1 precursor [Prunus serotina] |
| GenBank | AAL07434.1 | 0 | 7 | 103 | 387 | 484 | AF413213_1 prunasin hydrolase isoform PH C precursor [Prunus serotina] |
| GenBank | AAL07491.1 | 0 | 7 | 103 | 383 | 480 | AF414608_1 prunasin hydrolase isoform PH I precursor [Prunus serotina] |
| GenBank | AAL35324.1 | 0 | 7 | 103 | 412 | 509 | AF411131_1 prunasin hydrolase isoform PH C precursor [Prunus serotina] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 1e-30 | 16 | 103 | 408 | 497 | B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector |
| PDB | 3ptq_A | 1e-30 | 16 | 103 | 408 | 497 | B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector |
| PDB | 3ptm_B | 1e-30 | 16 | 103 | 408 | 497 | B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector |
| PDB | 3ptm_A | 1e-30 | 16 | 103 | 408 | 497 | B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector |
| PDB | 3ptk_B | 1e-30 | 16 | 103 | 408 | 497 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FF685187 | 94 | 12 | 103 | 4.00001e-40 |
| CV053243 | 113 | 1 | 103 | 2e-39 |
| CV051557 | 113 | 1 | 103 | 5e-39 |
| DN554270 | 79 | 25 | 103 | 2e-38 |
| AJ519342 | 104 | 2 | 103 | 2e-38 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Prunus persica | ppa019248m | ppa026712m | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |