| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa026712m |
| Family | GH1 |
| Protein Properties | Length: 121 Molecular Weight: 14186.2 Isoelectric Point: 7.4915 |
| Chromosome | Chromosome/Scaffold: 6 Start: 3645036 End: 3645520 |
| Description | beta glucosidase 31 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 25 | 119 | 3.2e-29 |
| EKCMNVILVYIAGMDEFNNPKLSLKQALDDANRIDYYYRHLCYLQAAIKEGANVQGYFAWSLLDNFEWRDGYTIWFGINYIDYDNGLERHSKLST | |||
| Full Sequence |
|---|
| Protein Sequence Length: 121 Download |
| MKSYSKLKAL KPCTYSYHIF SLDKEKCMNV ILVYIAGMDE FNNPKLSLKQ ALDDANRIDY 60 YYRHLCYLQA AIKEGANVQG YFAWSLLDNF EWRDGYTIWF GINYIDYDNG LERHSKLSTH 120 * |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR01233 | lacG | 2.0e-12 | 49 | 107 | 59 | + 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| PRK13511 | PRK13511 | 7.0e-15 | 52 | 120 | 69 | + 6-phospho-beta-galactosidase; Provisional | ||
| COG2723 | BglB | 1.0e-18 | 53 | 118 | 66 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam00232 | Glyco_hydro_1 | 5.0e-21 | 51 | 118 | 68 | + Glycosyl hydrolase family 1. | ||
| TIGR03356 | BGL | 6.0e-24 | 53 | 120 | 68 | + beta-galactosidase. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAA93032.1 | 0 | 17 | 120 | 412 | 516 | prunasin hydrolase isoform PH I precursor [Prunus serotina] |
| GenBank | AAF34651.2 | 1.4013e-45 | 25 | 120 | 414 | 511 | AF221527_1 putative prunasin hydrolase isoform PH-L1 precursor [Prunus serotina] |
| GenBank | AAL07434.1 | 0 | 24 | 120 | 387 | 484 | AF413213_1 prunasin hydrolase isoform PH C precursor [Prunus serotina] |
| GenBank | AAL07491.1 | 0 | 17 | 120 | 376 | 480 | AF414608_1 prunasin hydrolase isoform PH I precursor [Prunus serotina] |
| GenBank | AAL35324.1 | 0 | 24 | 120 | 412 | 509 | AF411131_1 prunasin hydrolase isoform PH C precursor [Prunus serotina] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 1e-30 | 33 | 120 | 408 | 497 | A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5. |
| PDB | 3ptq_A | 1e-30 | 33 | 120 | 408 | 497 | A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5. |
| PDB | 3ptm_B | 1e-30 | 33 | 120 | 408 | 497 | A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5. |
| PDB | 3ptm_A | 1e-30 | 33 | 120 | 408 | 497 | A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5. |
| PDB | 3ptk_B | 1e-30 | 33 | 120 | 408 | 497 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CV053243 | 126 | 5 | 120 | 9.99995e-41 |
| CV051557 | 124 | 7 | 120 | 4.00001e-40 |
| FF685187 | 94 | 29 | 120 | 5e-40 |
| DN554270 | 79 | 42 | 120 | 1e-39 |
| HE643507 | 105 | 17 | 120 | 4e-39 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Prunus persica | ppa019248m | ppa026632m | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |