y
Basic Information | |
---|---|
Species | Prunus persica |
Cazyme ID | ppa027174m |
Family | CBM43 |
Protein Properties | Length: 107 Molecular Weight: 11615.4 Isoelectric Point: 9.0056 |
Chromosome | Chromosome/Scaffold: 4 Start: 3739659 End: 3740247 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 25 | 102 | 3.2e-29 |
WCVAKPAAPQHALQSALDYACNYADCSPTKKGGSCYDPDRPVHHVSFAMNAYYQKMGRNQWNCHLNNTSLISLADPSR |
Full Sequence |
---|
Protein Sequence Length: 107 Download |
MAKLALPGPV ISLLLLFFFS GKKAWCVAKP AAPQHALQSA LDYACNYADC SPTKKGGSCY 60 DPDRPVHHVS FAMNAYYQKM GRNQWNCHLN NTSLISLADP SRPSIS* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 2.0e-15 | 25 | 92 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-28 | 25 | 101 | 78 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG36169.1 | 2e-22 | 18 | 106 | 19 | 107 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
EMBL | CBI30841.1 | 4e-23 | 16 | 101 | 86 | 171 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002275460.1 | 2e-23 | 16 | 101 | 26 | 111 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002285661.1 | 2e-23 | 11 | 106 | 17 | 112 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002528491.1 | 2e-25 | 1 | 101 | 1 | 110 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-17 | 24 | 101 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |