| Basic Information | |
|---|---|
| Species | Cucumis sativus |
| Cazyme ID | Cucsa.188640.1 |
| Family | CE11 |
| Protein Properties | Length: 139 Molecular Weight: 15221.5 Isoelectric Point: 7.2927 |
| Chromosome | Chromosome/Scaffold: 01298 Start: 42340 End: 42868 |
| Description | UDP-3-O-acyl N-acetylglycosamine deacetylase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE11 | 35 | 125 | 8.6e-32 |
| QQTLAGCLELSGISLHSGKVAKVKLCPEFAGRGRYFDFKSNFIPASIDYAEDSPLCTTLSKDGFKIRTVEHLLSAMEAMGVDNCRIVITNE | |||
| Full Sequence |
|---|
| Protein Sequence Length: 139 Download |
| MLVPTAFNAL KSSRSISWSP VFSLSLSIEM TGRLQQTLAG CLELSGISLH SGKVAKVKLC 60 PEFAGRGRYF DFKSNFIPAS IDYAEDSPLC TTLSKDGFKI RTVEHLLSAM EAMGVDNCRI 120 VITNEDAKDS EVEVRVTRA |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK13188 | PRK13188 | 2.0e-18 | 35 | 120 | 92 | + bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | ||
| TIGR00325 | lpxC | 2.0e-20 | 35 | 126 | 96 | + UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]. | ||
| pfam03331 | LpxC | 2.0e-21 | 35 | 126 | 96 | + UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A. | ||
| COG0774 | LpxC | 1.0e-22 | 33 | 122 | 95 | + UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane] | ||
| PRK13186 | lpxC | 1.0e-29 | 35 | 125 | 95 | + UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008759 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity |
| GO:0009245 | lipid A biosynthetic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI26831.1 | 0 | 1 | 136 | 1 | 126 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_001117351.1 | 1.4013e-45 | 1 | 136 | 1 | 140 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
| RefSeq | NP_173874.2 | 9.80909e-45 | 1 | 136 | 1 | 140 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
| RefSeq | NP_173884.5 | 2.94273e-44 | 1 | 136 | 44 | 183 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
| RefSeq | XP_002281269.1 | 0 | 1 | 136 | 1 | 126 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4fw7_D | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
| PDB | 4fw7_C | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
| PDB | 4fw7_B | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
| PDB | 4fw7_A | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
| PDB | 4fw6_D | 0.000000002 | 35 | 120 | 7 | 96 | A Chain A, Golgi Alpha-mannosidase Ii In Complex With Kifunensine |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GW831538 | 134 | 3 | 136 | 0 |
| BE053971 | 136 | 1 | 136 | 0 |
| BQ405531 | 133 | 4 | 136 | 0 |
| GW932242 | 132 | 5 | 136 | 0 |
| CU585894 | 131 | 6 | 136 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |