| Basic Information | |
|---|---|
| Species | Populus trichocarpa |
| Cazyme ID | Potri.T177300.1 |
| Family | CE11 |
| Protein Properties | Length: 148 Molecular Weight: 15813.1 Isoelectric Point: 6.4668 |
| Chromosome | Chromosome/Scaffold: 1655 Start: 24 End: 599 |
| Description | UDP-3-O-acyl N-acetylglycosamine deacetylase family protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CE11 | 25 | 114 | 3.9e-33 |
| QQTLKRCVEASGTTLHSGKSSTVRLLPELAGKGRYFYFNSKSIPASIDYAQESSLCTTLSNDGVKIRTVEHLLSALEAMSVDNCRIEITN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 148 Download |
| MAISGALNAL KSSKLISWKP CGRVQQTLKR CVEASGTTLH SGKSSTVRLL PELAGKGRYF 60 YFNSKSIPAS IDYAQESSLC TTLSNDGVKI RTVEHLLSAL EAMSVDNCRI EITNLDSDDS 120 DLDSEVGQTQ SVTWVCACVS VCVCVCV* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK13188 | PRK13188 | 5.0e-19 | 25 | 114 | 96 | + bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed | ||
| TIGR00325 | lpxC | 3.0e-24 | 25 | 114 | 94 | + UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]. | ||
| pfam03331 | LpxC | 7.0e-27 | 25 | 114 | 94 | + UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A. | ||
| COG0774 | LpxC | 5.0e-28 | 25 | 112 | 93 | + UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane] | ||
| PRK13186 | lpxC | 5.0e-35 | 25 | 114 | 94 | + UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008759 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase activity |
| GO:0009245 | lipid A biosynthetic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI26831.1 | 0 | 1 | 145 | 1 | 145 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_001117351.1 | 9.99967e-42 | 12 | 143 | 26 | 157 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Arabidopsis thaliana] |
| RefSeq | XP_002281269.1 | 0 | 1 | 141 | 1 | 141 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002315856.1 | 0 | 21 | 126 | 3 | 108 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002526001.1 | 1.99965e-42 | 1 | 126 | 1 | 130 | UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ps3_A | 0.00000000002 | 25 | 113 | 4 | 97 | A Chain A, Endo-Polygalacturonase Ii From Aspergillus Niger |
| PDB | 3ps2_A | 0.00000000002 | 25 | 113 | 4 | 97 | A Chain A, Endo-Polygalacturonase Ii From Aspergillus Niger |
| PDB | 3ps1_A | 0.00000000002 | 25 | 113 | 4 | 97 | A Chain A, Endo-Polygalacturonase Ii From Aspergillus Niger |
| PDB | 3p3g_A | 0.00000000002 | 25 | 113 | 4 | 97 | A Chain A, Crystal Structure Of The Escherichia Coli LpxcLPC-009 Complex |
| PDB | 3nzk_B | 0.00000000004 | 25 | 113 | 9 | 102 | A Chain A, Structure Of Lpxc From Yersinia Enterocolitica Complexed With Chir090 Inhibitor |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GW831538 | 113 | 2 | 114 | 0 |
| GW612707 | 115 | 1 | 113 | 0 |
| FC462005 | 105 | 8 | 112 | 0 |
| FG468569 | 106 | 9 | 114 | 2.8026e-45 |
| FG467854 | 114 | 1 | 114 | 4.2039e-45 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |