Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_8281735g0010 |
Family | GH47 |
Protein Properties | Length: 117 Molecular Weight: 13159.9 Isoelectric Point: 5.5623 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH47 | 3 | 113 | 2.4e-38 |
NETTETSTSGCGSLILEMGALSRLTGNPDYEAAALRALRKLWSMRSSLDLMGTTLDVLTGEWIEHSSGIGAGVDSFYEYLLKAYILFGRNEYWDMFHSAY VAVQKHFRHGP |
Full Sequence |
---|
Protein Sequence Length: 117 Download |
MENETTETST SGCGSLILEM GALSRLTGNP DYEAAALRAL RKLWSMRSSL DLMGTTLDVL 60 TGEWIEHSSG IGAGVDSFYE YLLKAYILFG RNEYWDMFHS AYVAVQKHFR HGPWCVK 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PTZ00470 | PTZ00470 | 1.0e-9 | 14 | 108 | 98 | + glycoside hydrolase family 47 protein; Provisional | ||
pfam01532 | Glyco_hydro_47 | 1.0e-34 | 14 | 114 | 105 | + Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2). |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | EEC73977.1 | 0 | 1 | 114 | 210 | 323 | hypothetical protein OsI_08885 [Oryza sativa Indica Group] |
RefSeq | NP_001048080.1 | 0 | 1 | 114 | 210 | 323 | Os02g0741300 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002318019.1 | 0 | 1 | 114 | 162 | 275 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002321565.1 | 0 | 1 | 114 | 198 | 311 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002454305.1 | 0 | 1 | 114 | 198 | 311 | hypothetical protein SORBIDRAFT_04g028330 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4ayr_A | 0.00000000008 | 7 | 93 | 157 | 243 | A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library |
PDB | 4ayq_A | 0.00000000008 | 7 | 93 | 157 | 243 | A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library |
PDB | 4ayp_A | 0.00000000008 | 7 | 93 | 157 | 243 | A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library |
PDB | 4ayo_A | 0.00000000008 | 7 | 93 | 157 | 243 | A Chain A, Structure Of The Gh47 Processing Alpha-1,2-mannosidase From Caulobacter Strain K31 |
PDB | 1nxc_A | 0.0000001 | 14 | 109 | 176 | 273 | A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases) |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX356065 | 114 | 1 | 114 | 0 |
CO171304 | 114 | 1 | 114 | 0 |
CO159839 | 114 | 1 | 114 | 0 |
CA176745 | 114 | 1 | 114 | 0 |
CN609866 | 103 | 12 | 114 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|