CAZyme Information: MGYG000001533_00656

Basic Information

• Species: Corynebacterium ammoniagenes
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium ammoniagenes
• CAZyme ID: MGYG000001533_00656
• CAZy Family: AA3
• CAZyme Description: Choline oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MGYG000001533_1|CGC3	56870.56	4.587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001533	2790185	Isolate	not provided	not provided

• Gene Location: Start: 655076; End: 656632 Strand: -

Full Sequence      

MADQKEYDYIIVGGGSSGSALAARLSENPDVTVALIEAGPHDSKHDEVLTLNRWPELLES
GLDWDYPIEKQENGNSFMRHSRAKVLGGCSSHNSCIAFHTPAEDVDLWEKLGATGWNRDT
VLPLIKKLETNDHEGDQNGHDGPVNIMTVPATDPVGVAVLDACEEVGIPRKNFNMGETVK
HGANFFQINSKQDGTRSSSSVSYLHPIEGRENLDILTDMWVSRIVFDDENNATGVEYQRD
VFGRRAVLNAKREVILSAGAINTPQLLMLSGIGPAEHLKEVGIDVRVDSPGVGSNLQDHP
EAVINFETTVDMVSDSTQWWEIGIFTQIDDNTDLPDLMMHYGSVPFDMHTVRQGYPTAEN
SFALTPNVTHARSRGTVRLRSNDFRDKPAVDPRYFTDEEGYDMRIAVAGIKLARKIASQP
ALADVVKRELSPGPEVQTDEEIADYVAKTHNTVYHPAGSCRMGSADDDMSPLDPELRVKG
VNRLRVADASVMPQLTAVNPNITCMMIGERAAQLVAEG

Enzyme Prediction     

No EC number prediction in MGYG000001533_00656.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	312	3.9e-100	0.5651408450704225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK02106	PRK02106	2.15e-148	4	515	3	531	choline dehydrogenase; Validated
COG2303	BetA	2.34e-134	1	517	2	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
TIGR03970	Rv0697	8.18e-81	8	516	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
pfam05199	GMC_oxred_C	3.45e-44	372	511	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
pfam00732	GMC_oxred_N	7.46e-38	7	301	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY64015.1	5.46e-138	7	516	14	531
APA11104.1	4.48e-136	6	517	13	541
CAK47101.1	4.49e-136	2	517	10	531
BCS15458.1	2.54e-135	2	517	10	531
QGI77692.1	1.05e-134	7	517	14	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.48e-257	5	515	12	526	Crystalstructure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	4.23e-257	5	515	12	526	Crystalstructure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	6.00e-257	5	515	12	526	ChainA, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6ZH7_A	7.16e-67	5	515	6	560	ChainA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	7.16e-67	1	515	3	560	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7X2H8	8.10e-257	5	515	12	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
Q8CMY2	1.74e-89	7	515	8	538	Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=betA PE=3 SV=1
Q5HL11	2.45e-89	7	515	8	538	Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=betA PE=3 SV=1
Q47944	9.09e-89	7	515	5	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
Q9X2M2	9.86e-89	4	515	2	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus xylosus OX=1288 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001533_00656.