CAZyme Information: MGYG000002962_00129

Basic Information

• Species: Clostridium sp900543325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp900543325
• CAZyme ID: MGYG000002962_00129
• CAZy Family: CBM22
• CAZyme Description: Endo-1,4-beta-xylanase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1221	MGYG000002962_2|CGC2	137297.14	4.1803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002962	3186188	MAG	China	Asia

• Gene Location: Start: 41038; End: 44703 Strand: -

Full Sequence      

MKNKKKIMSLLLSGLVILNPLSSIAVEAGEISKEVVFYDFEDGSNGKWYNSGEGKVEITA
DNPISGDYSLECYEGTQGCNGATLDLKELLKEGKTYDISFKIRAKDEGENSVNVTIYRQY
NLLDKNGNITGEKKEYYDNYEGGWLEGKNIVDAKINLTEAVALNGTYKLEDASKDKELIA
LNIKIESNNANLAYVIDDFSVSEKSNVESEDNEQATDEVKFNFEGENYDFTGRINSTVEA
VNEEAYEGNYSLKVSNRSETFDGPIINMTNYLEKGETYRISSWVKYNDGPDRKTFKVQFS
NEFIDKDAQYATIGEKNVKKGEWTLIEGEYTIPNSEDLNSYSFYMETSYKEIADSDPEST
DYDLMDFYIDEVKFVKVAKSDDKHEPDIKSLHEALTESLGQNFVIGTAVRPDQLEEGSEY
EALINKHFNAIVAENVMKVEPMRPSEDVYYWDDADTLVNYAYDNNKLMRGHALVWHSQMP
SWFFKDSEDSSKEVSSEDLLERMTEHITTVASRYAGKIYAWDVVNEVIADGVSENGLRRD
NENSKWARIIGDLDGDGDDDDYIEAAFRAARLADPNAKLIINEYGAESAGRKQDALYNLI
ERLLIAGVPVDGVGLQTHISMYNPDIKSIEATIERFSELKKYNPDFTVQITELDLSIYKS
DSDKEMPITSEVLLQQAYRYQELFDLFKEQTAKGNIDMTLVWGVTDNDSWLDNFPVEGRK
NAPLLFDRNFKAKPAYWALVDPNSLEIKTKSIEAKKVEKVNDLAWKLSNSIDVNKIIEGN
DGAKANVRVIWDEENIYINADITDTSLNENDSIEFYVGSAEAITIKRNSVNEKVDGSGYT
ATATVPVGDKSIEIEDTISFEVRINNYDNDNLKSVSVWNDVNGGEITEKDFGEIIFMSTA
KIANAIEGNPEIDGEIDDAWDKAEVINVNNFSVGKDGAIAEVRTLWSGKYLYVLAEVVDD
VLNSDNEYDHEKDSVELFVDLNNAKTPLYDEDDAQYRINYKNEASFNGNCNVDNFNSATK
IVEGGYIIEAAIYVGENKENSLIGFDVQVNDADATGKRVTVANWCDMSGMGWQRSSEYGN
LIMSKNVDVEAPDEENNIPIIIADDIVLNLGDEFNPYDRVIAKDKEDGDITDKVKVVKNT
VNTKRIGEYKVIYSVEDSKGASAIKEIKVIVTNKNIVSNNGDNNNSNKLPQTGNENVIYM
VIIAIIAIFIGSKLRYNKIIK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	399	741	1.4e-103	0.976897689768977
CBM9	912	1082	2.1e-44	0.989010989010989
CBM22	221	347	5.5e-31	0.9465648854961832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	1.90e-112	405	741	12	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	5.42e-101	437	739	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.28e-86	418	741	48	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
cd00005	CBM9_like_1	1.86e-77	902	1081	1	182	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
pfam06452	CBM9_1	5.29e-46	912	1083	1	181	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA07173.1	1.29e-226	25	1085	31	1085
QKS59245.1	1.82e-226	25	1085	31	1085
APO44853.1	1.52e-210	233	1085	59	939
BAA34091.1	6.15e-210	233	1085	60	940
QOS77886.1	7.61e-208	205	1083	34	939

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W8L_A	1.00e-123	395	747	5	349	Structureof GH10 from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4W8L_B Structure of GH10 from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4W8L_C Structure of GH10 from Paenibacillus barcinonensis [Paenibacillus barcinonensis]
6FHE_A	1.85e-84	403	740	21	339	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]
3W24_A	3.07e-79	403	741	17	325	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from Thermoanaerobacterium saccharolyticum JW/SL-YS485 [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
3W25_A	2.06e-78	403	741	17	325	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E146A mutant with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3W26_A The high-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E146A mutant with xylotriose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
3W27_A	2.06e-78	403	741	17	325	Thehigh-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E251A mutant with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3W28_A The high-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E251A mutant with xylotriose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3W29_A The high-resolution crystal structure of TsXylA, intracellular xylanase from /Thermoanaerobacterium saccharolyticum JW/SL-YS485/: the complex of the E251A mutant with xylotetraose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O69230	2.58e-227	25	1085	31	1085	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1
P36917	1.97e-197	39	1084	45	1043	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
P38535	6.41e-176	235	1084	58	895	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
Q60037	2.16e-144	56	1085	71	1059	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
Q60042	8.04e-139	25	1085	37	1055	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000300	0.998972	0.000198	0.000197	0.000164	0.000149

TMHMM  Annotations     

start	end
1197	1214