CAZyme Information: MGYG000000403_00006

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000000403_00006
• CAZy Family: PL21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1216	MGYG000000403_1|CGC1	136119.67	4.6227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000403	2138464	MAG	Sweden	Europe

• Gene Location: Start: 7679; End: 11329 Strand: +

Full Sequence      

MTKKYITRRFIAAVLSAAMLCGVAFSAFADGINYGDKVENPSIPLLLDEKNTVKNGNLVF
EAEDMKLASDMVIGQNENASGGKYITGATGTTKGSNSGNKNPSYSMNIKVEKSGPYSIWI
RARITHNGADSINLAVNSKHYEYFALPIEPDWQWINLKSTSLPAGMVAINFRYAEPPAWI
DKVLITADTEFVPKEMNDMPNAVEMGDVIYPEPEIKPISGHPRLFLTKDYIPELVKKREA
PELAKAWKVIDDWADLYIDAKLPERDSGNFSENILMRIQAKALKYVMDDSDKELADEVIR
LAKDYLKTVSFSNGGDVTRNRGDVMVMAAIVYDWCYDRMTDEDKQYFIKRFKELALEKEV
GYPPTNLSSVTSHTGEGEIMRDLLSAGIACYDEDTEIYNLAGGRFFSEMTEPRKMYYDAG
RHPEGSSYGPYRFQWEAFAAVIFDRMGIHNVFGENMKNVNYHWLYDMRPDGFRMKEGDEP
TFSAANYFYYMGTERRSAMIVGSLFKDPYIRGRYLKESASGGYVNDYFWTVLFDDPEVGA
KEPYDLPLTEFNGWPLSGMVARTSWQDGLDSPAVVASVTMKAINTGDHMHRDAGAFSIYY
KGALAIDSGEYQGQSGGYGYPHDMNYNKKSIAHNVVTVYDPDEKDNQVLSSTNDGGQRYP
RTSGMAKTLEELTADDAILAEEKAHSAGPNDKTPEYSYLKGDLTKAYTDKITDYKRSFVF
LNLDDEDYPAAAVVFDKVDSKKKEFKKKWLLHSIEEPDVEGDTTTIARTEYGFDGKLVNK
TLLPETKNLSIEKIGGSGKEFWVENQNFANAPKANGTEQGAWRIEVSPKNEAESDTFLNA
MYVTDNSSELPQLEAEKIETDDYVGALIKDRAVLFAKDSEPKNNEIKISCGKETAFLITD
VAEGTWQISGNGLNIFANSEKDGNCLYFRVPAGEYTVTPTEAHEETAENVPEMQVKTSGD
FTVWDEKARQFLYAESKLIDGVPYVQAKRIFEKYDSAVKWDGGTGEITISSGGKTIRIKS
GSTAAVMNKEEIQLQYAPVIIDGVTYVYPCDFTELTGKEFSFDETAKMLLVRDKKSEPVP
IKGIDEENVIKPVTVACSDSDTNIADNASDLDLTTRWSANGDGQWLMYDMGEVVPISRVA
LAFYLGSQRQTYFDIQLSNDAKTFTTVYSGASSGKTENPEFYPINYSARYIRFMGHGTAA
NRTGWNSVTEMTVLKK

Enzyme Prediction     

No EC number prediction in MGYG000000403_00006.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL21	573	642	1.6e-25	0.9583333333333334
CBM32	1098	1211	4.9e-19	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	7.11e-14	1098	1211	7	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam07833	Cu_amine_oxidN1	1.88e-13	979	1071	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
pfam18675	HepII_C	6.76e-09	858	938	2	87	Heparinase II C-terminal domain. Heparinase II (HepII) is an 85-kDa dimeric enzyme that depolymerizes both heparin and heparan sulfate glycosaminoglycans. The protein is composed of three domains: an N-terminal alpha-helical domain, a central two-layered beta-sheet domain, and a C-terminal domain forming a two-layered beta-sheet. The C-terminal domain contains nine beta-strands packed together in a manner resembling a beta-barrel.
cd00057	FA58C	3.98e-07	1093	1211	14	137	Substituted updates: Jan 31, 2002
cd04086	CBM35_mannanase-like	1.39e-04	59	165	2	98	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20141.1	1.59e-202	210	1209	228	1219
QHW00380.1	6.24e-169	217	938	67	799
ACU04612.1	4.20e-167	217	935	44	768
ABJ17170.1	1.16e-166	217	935	44	768
AAB18277.1	1.16e-166	217	935	44	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2FUQ_A	7.16e-169	217	935	19	743	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]
3E80_A	7.61e-169	217	935	21	745	Structureof Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_B Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_C Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus]
3E7J_A	4.78e-166	217	935	21	745	ChainA, Heparinase II protein [Pedobacter heparinus],3E7J_B Chain B, Heparinase II protein [Pedobacter heparinus]
2FUT_A	2.89e-163	217	935	20	744	ChainA, heparinase II protein [Pedobacter heparinus],2FUT_B Chain B, heparinase II protein [Pedobacter heparinus]
5ZU6_A	1.58e-24	1087	1214	29	157	ACBM32 derived from alginate lyase B (AlyB-OU02) [Vibrio]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6XZB6	8.41e-168	217	935	44	768	Heparin and heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000475	0.997311	0.001368	0.000412	0.000226	0.000171

TMHMM  Annotations     

start	end
12	34