CAZyme Information: MGYG000002295_00129

Basic Information

• Species: Ruminococcus_C callidus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C callidus
• CAZyme ID: MGYG000002295_00129
• CAZy Family: CBM4
• CAZyme Description: Cellulose 1,4-beta-cellobiosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1058	MGYG000002295_1|CGC2	115743.8	4.3576

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002295	2957494	Isolate	China	Asia

• Gene Location: Start: 132862; End: 136038 Strand: -

Full Sequence      

MLKKKLGKKALAFASAAVMAVSATATGLTALSMTAFAGEELGEGTFENGKGLPWHICENA
TAVMKFDITDGIYAIKLENIGGTANGGESRWDCQFRHRNLTIESGHTYRITYSVNPSNSG
HMYAKLGNMSKDDQELWHSNGDELSLSYEEGLTQEQLEEKLKSASKTGNKVDYGQGWDAW
YNKEYPANQWTTVAYEFQATETVKGTAEWTFHMGGQGNYAKMDCFPKDTIIRFDNLALID
MTDDASDYQAEAAYEPTGVEVNQVGYYPNGKKVATVVLSEGDTTKYDYEIKDASGSVVYS
GTTDGNTKYDELGAWDYTQQIDFTDFTTEGKGYTLTVAGKTSKSFDIDKNLYEKHHDKSM
LTYALNYFYQNRAMDTEDKYIPSPQSQEGSKKTLARKDSQHWPTDNAYIADKWVYIYTSK
PSYSQSINVAGGWFDAGDYGKYVVNGGISLWTLMNMYERSLMVGKADKFGDNSTVMSIPE
AGNGTPDILDECKVELDFFLEMMRDDGMVYHKAHDYKWTGLAVAPYDKNEGDKENKAPMR
IVKPVTYAATLNASATFAQAARLFKDYDAAYAKTMEDAAIKTYAAAQKNFKKFSGWGGDT
KGEGGISADLMYAPLDQNKGGGPYGDTEVSDEFYWAACELYITTGDKTYYDELMKYGTNA
YGTDNAKALEISTTLVGGENNGSFSLFTWGTLNSVGSISLYVNSQAMLDKGLLTQDEVNT
LKAEVLKAADSILEVQDKSAYGIPYVGHDYDTTVWKYNAASGTGDSETKTLSGGYEWGSN
SMVINNSMALALAYDASKEVKYIDGVTTSMDYLMGRNPLEQGYVTGYGEHSTTYPHHRWW
SGQLNSDDFPYAPYGVLSGGPNSNMEDPMVQGQGYKVGSIAPMKCYLDNVEAWSVNECTI
NWNSPLCWVASFLDDEAPYIERDPSSTTTATSSTDTKDTTTTTAATTAASTDASDATTDA
SNASTTDSNATTTSVTAASITPGQLLLGDTNLDGAVDVTDAVLLNKKAANVVTFNAQQML
NGDCYDQNGEIDGNDATALLKFLVHILKGLPENSSMNA

Enzyme Prediction     

EC	3.2.1.4	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	359	910	4e-102	0.9880382775119617
CBM4	42	214	1.5e-19	0.9682539682539683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	5.12e-74	360	910	2	374	Glycosyl hydrolase family 9.
pfam02927	CelD_N	8.36e-22	259	342	3	83	Cellulase N-terminal ig-like domain.
cd02850	E_set_Cellulase_N	2.22e-21	261	347	4	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd14256	Dockerin_I	1.01e-10	987	1044	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
PLN02345	PLN02345	1.31e-07	553	864	147	428	endoglucanase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17684.1	6.10e-249	1	1023	1	932
BAH56283.1	1.21e-217	35	914	170	1007
ADU21576.1	1.91e-209	29	912	22	798
AAR01216.1	4.57e-209	13	917	4	902
CAS03458.1	2.86e-208	13	917	8	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UT9_A	1.72e-128	259	914	7	605	ChainA, CELLULOSE 1,4-BETA-CELLOBIOSIDASE [Acetivibrio thermocellus]
1RQ5_A	4.86e-128	259	916	7	607	ChainA, Cellobiohydrolase [Acetivibrio thermocellus]
6DHT_A	1.07e-57	259	914	18	565	Bacteroidesovatus GH9 Bacova_02649 [Bacteroides ovatus ATCC 8483]
3X17_A	8.57e-56	261	911	20	554	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U0H_A	2.06e-37	268	915	3	542	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DCH1	3.32e-146	36	915	38	813	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celK PE=3 SV=1
P0C2S1	4.65e-146	36	915	38	813	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus OX=1515 GN=celK PE=1 SV=1
Q05156	2.85e-101	26	916	17	745	Cellulase 1 OS=Streptomyces reticuli OX=1926 GN=cel1 PE=1 SV=1
P14090	9.11e-100	254	930	333	932	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
P10476	4.73e-96	261	917	39	602	Endoglucanase A OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001333	0.997073	0.000232	0.000844	0.000261	0.000219

TMHMM  Annotations     

start	end
13	35