CAZyme Information: MGYG000003370_00337

Basic Information

• Species: Streptococcus mitis_AC
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mitis_AC
• CAZyme ID: MGYG000003370_00337
• CAZy Family: CBM40
• CAZyme Description: Sialidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697	MGYG000003370_3|CGC1	77713.07	6.4498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003370	1846494	MAG	United States	North America

• Gene Location: Start: 16261; End: 18354 Strand: -

Full Sequence      

MNKRGLYSKLGISVVGISLLMGVPTLIHANELNYGQLSISPIFQGGSYQLNNKSIDISPL
LLDKLSGESQTVVMKFKADKPNSLQALFGLSNSKAGFKNNYFSIFMRDSGEIGVEIRDAQ
KGINYLFSRPASLWGKHKGQAVENTLVFVSDSKDKTYTMYVNGIEVFSETVDTFLPISNI
NGIDKATLGAVNREGKDHYLAKGSIDEISLFNKAISDQEVSTIPLSNPFQLIFQSGDSTQ
ANYFRIPTLYTLSSGRVLSSIDARYGGTHDSKSKINIATSYSDDNGKTWSEPTFAMKFND
YEEQLVYWPRDNKLKNSQISGSASFIDSSIVEDKKSGKTILLADVMPAGIGNNNANKADS
GFKEINGHYYLKLKKDGDNDFRYTVRENGVVYDERTNKPTNYTVNDKYEVLEGGKSLTVE
QYSVDFDSGSLRETHNGKQVPMNVFYKDSLFKVTPTNYIAMTTSQNRGESWEQFKLLPPF
LGEKHNGTYLCPGQGLALKSSNRLIFATYTSGELTYLISDDSGQTWKKSSASIPFKNATA
EAQMVEMRDGVIRTFFRTTTGKIAYMTSRDSGETWSEVSYIDGIQQTSYGTQVSAIKYSQ
LIDGKEAVILSTPNSRNGRKGGQLVVGLVNKEDDSIDWKYHYDIDLPSYGYAYSAITELP
NHHIGVLFEKYDSWSRNELHLSNVVQYIDLEINDLTK

Enzyme Prediction     

EC	4.2.2.15	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	232	676	4.5e-76	0.9415204678362573
CBM40	44	225	3.1e-64	0.9720670391061452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4409	NanH	0.0	1	697	1	728	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam02973	Sialidase	1.97e-72	42	227	1	188	Sialidase, N-terminal domain.
cd15482	Sialidase_non-viral	1.06e-53	230	684	1	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.18e-13	459	666	82	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13385	Laminin_G_3	7.18e-07	95	221	39	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBP09272.1	0.0	1	697	1	697
ARD35268.1	0.0	1	697	1	697
AZT87744.1	0.0	1	697	1	697
AFC95267.1	0.0	1	697	1	697
ACO22908.1	0.0	1	697	1	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VW0_A	0.0	1	697	1	697	Crystalstructure of the NanB sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae],2VW1_A Crystal structure of the NanB sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae],2VW2_A Crystal structure of the NanB sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae],4FOQ_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-aminoethanesulfonic acid [Streptococcus pneumoniae],4FOV_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 3-Cyclohexyl-1-propylsulfonic acid [Streptococcus pneumoniae],4FOW_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 3-ammoniopropane-1-sulfonate [Streptococcus pneumoniae],4FOY_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-(Benzylammonio)ethanesulfonate [Streptococcus pneumoniae],4FP2_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2[(Cyclohexylmethyl)ammonio]sulfonate [Streptococcus pneumoniae],4FP3_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(Furan-2-ylmethyl)ammonio]sulfonate [Streptococcus pneumoniae],4FPC_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(4-Chlorobenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPE_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(4-Methoxybenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPF_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(3-Chlorobenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPG_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(3-Hydroxybenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPH_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(3-Fluorobenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPJ_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(3-Methoxybenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPK_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(3-methylbenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPL_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(3,4-dichlorobenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPO_B Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(3-chloro-4-methoxybenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FPY_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(3-Bromobenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae],4FQ4_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 2-[(4-Fluoro-3-methylbenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae]
4XE9_A	0.0	39	696	1	658	Crystalstructure of the NanB sialidase from Streptococcus pneumoniae in complex with Optactin [Streptococcus pneumoniae TIGR4],4XHB_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with pentanediol and CHES [Streptococcus pneumoniae TIGR4],4XHX_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with Optactin and 2-[(3-Chlorobenzyl)ammonio]ethanesulfonate [Streptococcus pneumoniae TIGR4],4XIK_A Crystal structure of NanB sialidase from streptococcus pneumoniae in complex with DMSO [Streptococcus pneumoniae TIGR4],4XIL_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with Optactin at pH 7.4 in PBS with MPD as the cryoprotectant [Streptococcus pneumoniae TIGR4],4XIO_A Crystal structure of apo NanB sialidase from streptococcus pneumoniae at pH 8.0 with MPD as the cryoprotectant [Streptococcus pneumoniae TIGR4],4XJ8_A Crystal structure of apo NanB sialidase from streptococcus pneumoniae at pH 5.0 in 50mM sodium Acetate with DMSO [Streptococcus pneumoniae TIGR4],4XJ9_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with Optactin at pH 5.0 in 50mM Sodium Acetate with DMSO as the cryoprotectant [Streptococcus pneumoniae TIGR4],4XJA_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 5-acetamido-2,3-difluoro-3-hydroxy-6-[1,2,3-trihydroxypropyl]oxane-2-carboxylic acid [Streptococcus pneumoniae TIGR4],4XJU_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with 4-acetamido-2-fluoro-3-hydroxy-6-[1,2-dihydroxyethyl]-7,8-dioxabicyclo[3.2.1]octane-1-carboxylic acid [Streptococcus pneumoniae TIGR4],4XJW_A Crystal structure of the NanB sialidase from streptococcus pneumoniae in complex with Optactin at pH 7.4 in PBS with DMSO as the cryoprotectant [Streptococcus pneumoniae TIGR4],4XJZ_A Crystal structure of apo NanB sialidase from streptococcus pneumoniae at pH 7.4 in PBS with DMSO [Streptococcus pneumoniae TIGR4]
4XMA_A	0.0	39	696	1	658	Crystalstructure of the K499G mutant of NanB sialidase from streptococcus pneumoniae in complex with Optactin [Streptococcus pneumoniae TIGR4],4XMI_A Crystal structure of the K499G mutant of NanB sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4XOG_A	0.0	37	696	1	660	CRYSTALSTRUCTURE OF THE NANB SIALIDASE FROM STREPTOCOCCUS PNEUMONIAE IN COMPLEX WITH Optactin and DANA [Streptococcus pneumoniae TIGR4]
4XYX_A	0.0	40	697	1	658	NanBplus Optactamide [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54727	0.0	1	697	1	697	Sialidase B OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=nanB PE=1 SV=2
Q27701	3.06e-178	71	696	118	756	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
P29767	3.88e-50	68	669	220	809	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P15698	1.62e-06	232	360	41	145	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000310	0.998968	0.000231	0.000166	0.000162	0.000144

TMHMM  Annotations     

start	end
5	27