CAZyme Information: MGYG000000676_00102

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia
• CAZyme ID: MGYG000000676_00102
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		72383.37	6.5099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000676	2188584	MAG	Kazakhstan	Asia

• Gene Location: Start: 113542; End: 115419 Strand: -

Full Sequence      

MQSADFPLYVFHQGKNFRAYDFFGAHPFAEGGKKGFVFRVWAPHAEEVSVVGDFNSWDPA
AHPMQRLQDGESFEIAIAGIKNFTAYKYCIKAKDGRFLYKADPYAFHAETPSKTASKTFD
LSKFKWSDKEYIKARNARNVYDSPMNIYEMNALSWRQYGDGNYFAFDKLVEDLIPYLLDM
GYTHVEFMPLSEYPYDASWGYQVTGYYAITSRLGTPCDFMRLVNELHKNGIGVILDWVPA
HFPKDAHGLYEFDGEPLYESSAWDRKEHKSWGTHRFDYGRAEVLSFLISNAVFFFDKFHI
DGLRVDAVASMLYLDYDKKPGEWLPNKYGENKNLEAVDFLQRLNTTVFAEYPHALMIAEE
STAWPLVTKPADIGGLGFNFKWNMGWMNDVLDYMQTDPYFRKGNHNKLTFSMMYAFTENY
ILPISHDEVVYGKRSLIDKMPGTYEEKFANLRAFMGFMMSHPGKKLLFMGCEFGQFKEWN
YNEGLEFFLKDYPLHQKLSDMNAALNRIYRETPALYEIEDSWDGFEWLAVDDADRNMLAY
MRKDRTGKCIAVIINFSGVASVGYRLGMPKGKYRLLFNSDSAAFGGSGQLKKRVFETRKK
PSHGKEYSIEIELPKLTCVYLEKIL

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	175	475	1.6e-155	0.9966777408637874
CBM48	23	110	4.6e-19	0.9210526315789473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14705	PRK14705	0.0	8	616	608	1215	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	5	622	8	627	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	5	622	102	722	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	0.0	5	622	9	626	1,4-alpha-glucan branching protein GlgB.
TIGR01515	branching_enzym	0.0	8	621	2	617	alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL01646.1	4.67e-276	3	622	12	632
AXB29737.1	1.01e-274	3	622	12	632
QIA41789.1	4.11e-272	4	622	13	632
ATO99826.1	4.11e-272	4	622	13	632
CBK98932.1	5.43e-272	4	622	13	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	1.98e-198	4	622	130	772	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	2.24e-197	4	622	130	772	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR5_A	3.17e-197	4	622	130	772	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR0_A	3.17e-197	4	622	130	772	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	4.49e-197	4	622	130	772	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	5.51e-238	4	624	7	628	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
O66936	1.18e-224	4	622	8	627	1,4-alpha-glucan branching enzyme GlgB OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgB PE=3 SV=1
Q1AZ86	2.63e-218	4	621	100	717	1,4-alpha-glucan branching enzyme GlgB OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1) OX=266117 GN=glgB PE=3 SV=1
Q0SWZ1	6.03e-218	8	625	37	658	1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=glgB1 PE=3 SV=1
Q8XPA2	1.39e-216	8	625	37	658	1,4-alpha-glucan branching enzyme GlgB 1 OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000676_00102.