CAZyme Information: MGYG000000010_01225

Basic Information

• Species: Staphylococcus_A lentus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus_A; Staphylococcus_A lentus
• CAZyme ID: MGYG000000010_01225
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000000010_9|CGC1	35457.63	10.2903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000010	2726400	Isolate	United Kingdom	Europe

• Gene Location: Start: 3247; End: 4242 Strand: -

Full Sequence      

MKKKTLTAFVGASVAVALTSQSAEAASYKVKSGDSLWLIAEKHNTTIAKIKSLNKLSSNL
IFPNQIIQVPGSSSSSNTNTGSTSTSSTTYYTVKSGDSLSVIAGKYGTTYQKIMSLNGLN
NTIIYPGQKLKVKGTSSSSSSNNTGSSNTSTSTTTYTVKSGDSLSVIAARYGTTYQKIMS
LNGLSNFIIYPGQKLKVSGSVSTGGGQSSSNNTGSYTPPMFYHQNLYDWGQCTWHVFNRR
KAIGKPISTYWWNANNWASAAAKDGYRVNHKPAVGSILQSSAGYYGHVSFVERINNDGSI
QVSEMNFTSSPGVLTYRTVPASLVPSYNFIH

Enzyme Prediction     

No EC number prediction in MGYG000000010_01225.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	156	197	1.3e-16	0.95
CBM50	91	132	4.5e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	7.11e-34	173	331	9	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	4.95e-27	19	218	324	537	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	8.70e-26	11	197	391	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	3.44e-16	11	133	465	592	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	3.73e-16	227	322	508	608	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMU11697.1	9.73e-212	1	331	1	331
QJF25746.1	7.17e-182	1	331	1	332
QTN11409.1	7.17e-182	1	331	1	332
QRO84148.1	7.17e-182	1	331	1	332
QQT14564.1	7.17e-182	1	331	1	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	4.10e-36	225	331	50	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	3.83e-34	225	331	9	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	3.29e-18	227	330	248	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
2MKX_A	6.48e-09	87	133	3	49	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]
4UZ2_A	1.81e-08	156	197	5	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q49UX4	1.08e-138	1	331	1	327	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q2G0U9	3.50e-134	1	331	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sle1 PE=1 SV=1
Q6GC24	3.50e-134	1	331	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1
Q5HIL2	3.50e-134	1	331	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1
Q7A1T4	3.50e-134	1	331	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000280	0.998904	0.000208	0.000208	0.000201	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000010_01225.