CAZyme Information: MGYG000001162_00152

Basic Information

• Species: UBA1822 sp900545365
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822; UBA1822 sp900545365
• CAZyme ID: MGYG000001162_00152
• CAZy Family: CBM50
• CAZyme Description: Elongation factor 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		92018.95	9.5434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001162	1612933	MAG	Austria	Europe

• Gene Location: Start: 66223; End: 68739 Strand: -

Full Sequence      

MPKYRVYELAKMFGKTNEEVIDILKKNQYEVTRAVNSVDEKAKEILDRELAAKKPAKKPA
FRTVRFDSKGRPQDGRKTQGQGGFSASYSTDGAEQEARAAAMKKAAPQKQEARPAAKPEG
QRPAARPQGQRPAESRPAHGESRPGDRKDGRPQQRQGGDRGGFRQDRPAGRQDRPGDRRD
SRPKQAAPQNRPKPAAAPAPAPAPAAEQRRAEKPAKKSKKDYERSRREKEGTSLMAQSMK
QNKKKKHGGEKKAVSYPTEVTLPPSATVKDLANLFGREVSEVIMQLMKLGIMATINQNVD
PDAAALLADEFGVTLLEPEKTADPTEYTPAPDDPRFLKPRPPVVTIMGHVDHGKTTLLDA
FRQTDVALHEAGGITQRIGAYQIRYKNQKITFLDTPGHEAFTAMRTRGAQVTDVAVIIVA
ADDGVMPQTVEAINHAKSAGVPIIVAINKIDKPGANPDHIKEELSHQGLIAEDWGGDVIM
VPISAKKRIGLDELLDNILLVAEMEELKANPRREAYGVVIEAQLDKGRGPVMNVLVQNGT
LHVGDGILAGKCWGRVRAMANETGRKLKSAEPSAPAEILGMSGVPEAGDHFYVMDERKAR
EIAEMRAVRAKEEERGRVQKITLDNIFDKIKEGEMKELDIIIKADVQGSVEALQQSLENI
KSEKVRISVVHSAVGAISESDIMLASASNALIIGFNVRPDANARKLAEQEKIDVRLYRVI
YDVINDVKAAMAGLLAPTIKEVLLGHAEVRQVIHTPKVIVAGSYVTDGKITSNCQLRIVR
DGIVIHEGKINSLRRFKDDVKEVTEGYECGIAIDNYRDVKEGDQLEAFKLQEEAAELE

Enzyme Prediction     

No EC number prediction in MGYG000001162_00152.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00487	IF-2	0.0	257	832	3	581	translation initiation factor IF-2. This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU. [Protein synthesis, Translation factors]
CHL00189	infB	0.0	214	837	114	742	translation initiation factor 2; Provisional
PRK05306	infB	0.0	1	834	1	744	translation initiation factor IF-2; Validated
COG0532	InfB	0.0	337	838	1	508	Translation initiation factor IF-2, a GTPase [Translation, ribosomal structure and biogenesis].
cd01887	IF2_eIF5B	4.39e-98	342	505	1	169	Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family. IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits. As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states. Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments. This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGL64345.2	2.11e-201	257	832	274	854
CAE6204650.1	2.28e-11	345	545	751	968
AHC21644.2	9.85e-09	346	464	20	160
AGL63702.2	2.26e-08	346	464	18	158

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JCJ_f	6.29e-195	248	832	298	884	Structuresof ribosome-bound initiation factor 2 reveal the mechanism of subunit association [Escherichia coli],3JCN_b Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association: Initiation Complex I [Escherichia coli],5ME0_W Chain W, Translation initiation factor IF-2 [Escherichia coli K-12],5ME1_W Structure of the 30S Pre-Initiation Complex 2 (30S IC-2) Stalled by GE81112 [Escherichia coli K-12]
6O7K_f	4.03e-185	338	832	7	503	30Sinitiation complex [Escherichia coli],6O9K_z 70S initiation complex [Escherichia coli]
1ZO1_I	1.22e-184	338	832	1	497	IF2,IF1, and tRNA fitted to cryo-EM data OF E. COLI 70S initiation complex [Escherichia coli]
5LMV_a	1.07e-148	268	832	6	568	Structureof bacterial 30S-IF1-IF2-IF3-mRNA-tRNA translation pre-initiation complex(state-III) [Thermus thermophilus HB8]
3J4J_A	1.41e-148	268	832	6	568	Modelof full-length T. thermophilus Translation Initiation Factor 2 refined against its cryo-EM density from a 30S Initiation Complex map [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3AB98	3.22e-239	257	838	243	827	Translation initiation factor IF-2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) OX=246194 GN=infB PE=3 SV=1
Q24UI6	2.96e-235	257	837	390	971	Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) OX=138119 GN=infB PE=3 SV=1
B0K1D6	2.11e-234	260	832	114	689	Translation initiation factor IF-2 OS=Thermoanaerobacter sp. (strain X514) OX=399726 GN=infB PE=3 SV=1
B0K9Q0	8.18e-234	260	832	113	688	Translation initiation factor IF-2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=infB PE=3 SV=1
C5D9C9	3.30e-233	257	832	150	728	Translation initiation factor IF-2 OS=Geobacillus sp. (strain WCH70) OX=471223 GN=infB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001162_00152.