CAZyme Information: MGYG000001318_00287

Basic Information

• Species: Enterobacter cancerogenus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter cancerogenus
• CAZyme ID: MGYG000001318_00287
• CAZy Family: CBM50
• CAZyme Description: 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647		70765.18	5.8865

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001318	4633453	Isolate	not provided	not provided

• Gene Location: Start: 75869; End: 77812 Strand: -

Full Sequence      

MIKFSATLLATLIAASVQAATVDLRILETTDLHSNMMDFDYYKDTPTEKFGLVRTASLIN
AARGEVKNSVLVDNGDVIQGSPLGDYMAAKGIKKGEIHPVYKAMNTLDYTVGNLGNHEFN
YGLTYLHDALAGAKFPYVNANIIDVKTQKPLFTPYLIKETQVVDKDGNTQTLKIGYIGFV
PPQIMTWDKANLDGKVTVNDITETARKYVPEMREKGADVVVVVAHSGLSADPYQVMAENS
VYYLSEVKGVDAILFGHAHAVFPGKDFASIKGADIDKGTLNGVPSVMPGMWGDHLGVVDL
VLNNDSGSWKVIQSKAEARPIYDAAAKKSLAGEDKKLVDVLKHDHDATREFVSKPIGKSA
DNMYSFLALVQDDPTVQVVNMAQKAYAEHYIQGDPDLAKLPVLSAAAPFKVGGRKNDPAS
YVEVEKGQLTFRNAADLYLYPNTLVVVKATGSEVKEWLECSAGQFNQIDPNSSKPQSLIN
WDGFRTYNFDVIDGVKYQIDVTQPAKYDGECQAIHPQAERIKNLTFNGKAIDPNATFLVV
TNNYRAYGGKFAGTGDDHIAFASPDENRSVLAAWIGAESKKTGAIHPAVDNNWRLAPIHS
DTPLDIRFETSPSDKAATFIKDKAQYPMKKVATDDIGFAIYQVDLSK

Enzyme Prediction     

No EC number prediction in MGYG000001318_00287.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01390	CycNucDiestase	0.0	22	647	1	626	2',3'-cyclic-nucleotide 2'-phosphodiesterase. 2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]
PRK11907	PRK11907	0.0	5	642	97	722	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK09420	cpdB	0.0	1	647	3	649	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK09419	PRK09419	0.0	1	645	18	647	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
PRK09418	PRK09418	0.0	20	647	36	654	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANF95373.1	3.97e-235	20	647	38	666
QZN77538.1	1.25e-232	15	646	29	664
APO43595.1	1.89e-231	15	646	27	662
QLG37215.1	6.90e-231	15	646	29	664
QOS76560.1	3.51e-230	15	646	29	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JYF_A	6.82e-203	16	354	1	339	ChainA, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578],3JYF_B Chain B, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
5EQV_A	5.82e-192	15	354	1	340	1.45Angstrom Crystal Structure of Bifunctional 2',3'-cyclic Nucleotide 2'-phosphodiesterase/3'-Nucleotidase Periplasmic Precursor Protein from Yersinia pestis with Phosphate bound to the Active site [Yersinia pestis CO92]
3GVE_A	2.14e-97	19	354	7	341	Crystalstructure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GVE_B Crystal structure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3QFK_A	1.27e-35	30	549	26	482	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus NCTC 8325]
4Q7F_A	1.27e-35	30	549	26	482	ChainA, 5' nucleotidase family protein [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26265	0.0	1	647	1	647	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=cpdB PE=3 SV=2
P08331	0.0	1	647	1	647	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2
P53052	0.0	7	647	9	652	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica OX=630 GN=cpdB PE=3 SV=1
P44764	1.20e-300	22	647	32	657	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=cpdB PE=3 SV=1
O34313	1.58e-179	19	643	40	651	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000247	0.999125	0.000160	0.000164	0.000156	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001318_00287.