CAZyme Information: MGYG000002299_00565

Basic Information

• Species: Vagococcus sp003462485
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Vagococcaceae; Vagococcus; Vagococcus sp003462485
• CAZyme ID: MGYG000002299_00565
• CAZy Family: CBM50
• CAZyme Description: Vitamin B12 import ATP-binding protein BtuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000002299_1|CGC4	39853	9.0677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002299	2039592	Isolate	China	Asia

• Gene Location: Start: 542335; End: 543399 Strand: +

Full Sequence      

MNQKENPKVELTMITKEYDLYKKKSDKIKALFKFSEKRVPHFWGLRGIDLKVYPGEAVGL
IGINGSGKSTLSNILAGIIPQTTGQMTIKGETSIIAIGAGLKPQLTGLENIRLKCLMQGL
TNEEVDAILPDITEFADIGDFVNQPVKNYSSGMRSRLGFAIAVHNNPDVLIIDEALSVGD
DTFYQKCVDRILQFKAEGKTIFFVSHSLNQVKKLCDKVAWIHYGELREYGDTAEVVANYN
KFIKWFRTLSEQEKKEYQDDYKEKQKNFSVDDLKKIASERGHGKSALRGPAIGTMSLLTK
VVLLFMIVGIVVFGTINIRGRSFKSYFAEKQTPQVEKQLARDISAEQLYETFID

Enzyme Prediction     

No EC number prediction in MGYG000002299_00565.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1134	TagH	1.11e-105	6	250	1	249	ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
PRK13545	tagH	2.37e-104	6	351	2	336	teichoic acids export protein ATP-binding subunit; Provisional
cd03220	ABC_KpsT_Wzt	1.87e-95	9	230	1	224	ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.
PRK13546	PRK13546	1.49e-94	6	266	2	261	teichoic acids export ABC transporter ATP-binding subunit TagH.
COG1131	CcmA	1.21e-45	41	281	17	270	ABC-type multidrug transport system, ATPase component [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD25608.1	7.75e-107	8	300	6	298
AUC58829.1	7.75e-107	8	300	6	298
QPB60328.1	7.75e-107	8	300	6	298
AYZ07349.1	7.75e-107	8	300	6	298
QCJ67441.1	7.75e-107	8	300	6	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DD0_A	2.88e-109	8	285	4	279	Crystalstructure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_B Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_C Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_D Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
6JBH_A	7.41e-92	14	265	10	260	Cryo-EMstructure and transport mechanism of a wall teichoic acid ABC transporter [Alicyclobacillus herbarius],6JBH_B Cryo-EM structure and transport mechanism of a wall teichoic acid ABC transporter [Alicyclobacillus herbarius]
6AMX_A	9.71e-57	14	241	6	233	CrystalStructure of Nucelotide Binding Domain of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6AN5_A Crystal Structure of The Nucelotide Binding Domain of an O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6AN5_B Crystal Structure of The Nucelotide Binding Domain of an O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6OIH_A Crystal structure of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6OIH_B Crystal structure of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5]
6M96_A	2.89e-56	14	241	8	235	ATP-boundconformation of the WzmWzt O antigen ABC transporter [Aquifex aeolicus VF5]
7K2T_A	1.09e-54	14	243	8	237	ChainA, ABC transporter [Aquifex aeolicus VF5],7K2T_C Chain C, ABC transporter [Aquifex aeolicus VF5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03SI5	8.52e-123	8	271	6	269	Teichoic acids export ATP-binding protein TagH OS=Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947) OX=387344 GN=tagH PE=3 SV=1
Q8Y843	1.25e-120	6	337	4	325	Teichoic acids export ATP-binding protein TagH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=tagH PE=3 SV=1
Q92CV8	5.04e-118	6	337	4	323	Teichoic acids export ATP-binding protein TagH OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=tagH PE=3 SV=1
Q720Z5	8.22e-117	6	337	4	323	Teichoic acids export ATP-binding protein TagH OS=Listeria monocytogenes serotype 4b (strain F2365) OX=265669 GN=tagH PE=3 SV=1
Q88ZH4	1.04e-116	8	325	6	337	Teichoic acids export ATP-binding protein TagH OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=tagH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
292	314