CAZyme Information: MGYG000002343_00111

Basic Information

• Species: Acinetobacter courvalinii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter courvalinii
• CAZyme ID: MGYG000002343_00111
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
950	MGYG000002343_1|CGC1	106473.63	5.2599

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002343	4074146	Isolate	United States	North America

• Gene Location: Start: 119727; End: 122579 Strand: +

Full Sequence      

MLNNIFQALDSLGLTAQKRALHILFSNQDLNTQVFLQRIDGQHQINAGVEAELICLSTNA
TIPLKQFIGSQVAVDQVTDTGQLFRTTGIITQALQGQSDGSLTVYKLTLQDPTALWHKRR
NSRVFMNKSVRDVVELVFKEWQQKSPLFAASLTLDLSGLSQDYDIRPFIMSQNESDYDFL
TRLMRSEGINWLIDEAQLIVPNSNSSIQPQRLRLIDDNAQYQALDRRKVQYHRSSATEQF
DSITSFIGNRSLQPTSVYVNRWQPDALDMDEGTGSVLTTQQHSEQHDATRLALEDAWHFT
PAWMQDLNKEDGATPSGNQQVERFNQNLSHYHNAQAKQFIAQSTLRDAQVGYWFELQDHP
EIDQHDGADKEFLITAKHFYNQNNLPKDLHQQIDQLLAQSQWQPKQFNTGNTEERQANQL
TLQRRQIKIVPAYNPQQHRPEAYPQRAKVVGPSGEEIHVDEWGRIKVRFLFTRTEDHSHD
GGAGANDNDTDSAWIDVLTPWAGEGYGARFLPRIGEIVVIDFFDGNIDRPYVVGRIHEAQ
RSPTRFDKAGKLPDTKKLAGIKSKEYQGEGFNQLRFDDTTGQISAQLQSSHAATQLNLGK
LSHPKDKAESEDRGEGFELRTDQWGAVRAGQGLLLSTQKQDQAQGEHLDAQPAKQQIEGN
QSNAKALSEVAKNQQTDEIESLDQLKDFADQIQDKIAKFEKALLLLNSPAGIGLSTNEDI
HLSADGQINQIAGDSINLSTQKNLVAHVQNRISLFAAQNGIKQVAAKGKFEVHVQSDGMD
LLAKQGIQIISTEDRIEITSPKEIVFTAQGSQLKLNGSGIFPTTGGKFEVKAGQHLFMGG
GTVKQNLPIFPALSMPKNLLEFRKVYADGTPSPNIPYTIHLPDGTTQQGKTDSNGMAFYA
DQKNGRAVIEYGDDRNPLESALEMKFEQELDNLFKTEIFVLPLVDDQSEE

Enzyme Prediction     

No EC number prediction in MGYG000002343_00111.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3501	VgrG	1.51e-98	16	631	7	532	Uncharacterized conserved protein, implicated in type VI secretion and phage assembly [Intracellular trafficking, secretion, and vesicular transport, Mobilome: prophages, transposons, General function prediction only].
TIGR03361	VI_Rhs_Vgr	7.31e-78	36	582	14	485	type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.
pfam05954	Phage_GPD	1.28e-64	42	385	1	305	Phage late control gene D protein (GPD). This family includes a number of phage late control gene D proteins and related bacterial sequences. This family also includes Bacteriophage Mu P proteins and related sequences.
TIGR01646	vgr_GE	8.55e-54	34	591	1	482	Rhs element Vgr protein. This model represents the Vgr family of proteins, associated with some classes of Rhs elements. This model does not include a large octapeptide repeat region, VGXXXXXX, found in the Vgr of Rhs classes G and E.
COG4253	COG4253	7.34e-52	647	895	1	258	Uncharacterized conserved protein, DUF2345 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ63848.1	0.0	1	855	1	855
ATZ63530.1	0.0	1	854	1	858
QIP93854.1	4.23e-32	87	581	208	624
AZS26707.1	7.20e-30	48	589	41	505
ASW82516.1	7.20e-30	48	589	41	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SJL_A	2.83e-38	88	895	89	814	Structureof the Tle1 effector bound to the VgrG spike from the Type 6 secretion system [Escherichia coli],6SJL_B Structure of the Tle1 effector bound to the VgrG spike from the Type 6 secretion system [Escherichia coli],6SJL_C Structure of the Tle1 effector bound to the VgrG spike from the Type 6 secretion system [Escherichia coli],6SK0_A The VgrG spike from the Type 6 secretion system [Escherichia coli],6SK0_B The VgrG spike from the Type 6 secretion system [Escherichia coli],6SK0_C The VgrG spike from the Type 6 secretion system [Escherichia coli],6SKI_A The Tle hydrolase bound to the TTR domain of the VgrG spike of the Type 6 secretion system [Escherichia coli]
4MTK_A	3.23e-31	34	581	18	492	Crystalstructure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_B Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_C Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_D Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_E Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_F Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],6H3L_A Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3L_B Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3L_C Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3N_A Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1],6H3N_B Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1],6H3N_C Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1]
4UHV_A	7.76e-30	34	581	18	492	Thestructure of VgrG1, the needle tip of the bacterial Type VI Secretion System [Pseudomonas aeruginosa PAO1],4UHV_B The structure of VgrG1, the needle tip of the bacterial Type VI Secretion System [Pseudomonas aeruginosa PAO1]
7Q5P_A	5.46e-29	34	581	21	495	ChainA, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5],7Q5P_B Chain B, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5],7Q5P_C Chain C, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5]
2P5Z_X	1.11e-08	88	539	89	473	TheE. coli c3393 protein is a component of the type VI secretion system and exhibits structural similarity to T4 bacteriophage tail proteins gp27 and gp5 [Escherichia coli O6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I6M7	6.65e-64	444	895	370	811	Type VI secretion system spike protein VgrG2b OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG2b PE=1 SV=1
Q9I3K1	1.19e-56	444	895	370	811	Type VI secretion system spike protein VgrG2a OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG2a PE=3 SV=1
Q9I0F3	8.96e-31	36	581	60	532	Type VI secretion system spike protein VgrG1c OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1c PE=1 SV=1
Q9I741	1.77e-30	34	581	18	492	Type VI secretion system spike protein VgrG1a OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1a PE=1 SV=1
Q9I737	5.15e-30	36	581	23	495	Type VI secretion system spike protein VgrG1b OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=vgrG1b PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002343_00111.