CAZyme Information: MGYG000002724_00458

Basic Information

• Species: CAG-83 sp900549395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-83; CAG-83 sp900549395
• CAZyme ID: MGYG000002724_00458
• CAZy Family: CBM50
• CAZyme Description: Trifunctional nucleotide phosphoesterase protein YfkN

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1197	MGYG000002724_3|CGC1	131044.15	5.1548

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002724	2055891	MAG	Canada	North America

• Gene Location: Start: 70205; End: 73798 Strand: -

Full Sequence      

MKKILSLFLTLAIVIGLFVPAASAEPTTGATTTEFAFLVTSDLHGQIYSTDYSAGYEASG
TGTTGLTRIATYIKQMRAKYGENLYLADLGDTIQGAPLTYYYAFNKPEADDPAMKAFRTL
GYDLWVPGNHEFNYGLDILNRQMDYLTSAASGKETPAAIMAANYLDAQARAADPNSWKTW
KNYKPYEIRKFDGVKVAIIGLANPNIPKWDIPANWEGIHFAGIYETYKHYEAEMKAQADM
IAVMTHCGMAYTSEAGDLAMDSVKYLVEKTNSIDFVFSGHEHGTKVLSANNTDGKSIPIV
QPNTKAKAIGQIIVTYDKDKKAVTSLDATNVSMTQKVSGKTVPCYDIDQELGQILKPYEE
ATWKDYMLQVIGQSNGDYSAAGLGTAPSAFMDLVNRVQILGAYDRTGKNTPNNPDDDTPA
QLSISAPLTSGSKENLIPKGDICLGDMFSLYRFENWFYQIRMSGKEVRTWLEYSASKIYE
NNGKLDIKGGLTYYDVIYGDGFSYTIDAAQPAGSRVVKMTYNAKPVTDDQEFTVVLNNYR
FNGGGDYVNYLNKHGCNFKANDPDRIIYSSQFDMINGEDEGQARSLLVSYIKEQTAGQSK
GITPNITSNWKIINSSSAKSDDIVVLYTNDVHTYIDNKTGKGLRYSDVAGYRDDLLDTHK
NVLLVDAGDHVQGTAYGGMDSGATILKLMQTAGYDLATLGNHEFDYGMERALAIAKNGIV
PYISCNFYHEKDGVKGANVLDSYKIFDLDGKKVAFVGITTPESFTKSTPKYFQDSNGNYI
YGIAGGVDGQALYDSVQAAIDAVKAAGADYVIGLAHLGVDESSRPWTSKDVIAHVTGLDA
LLDGHSHSVVEQELVKDKAGHDVVLSQTGSYLKNLGQLTITANGQITTKLLSSVSTVQNW
AVKELEDAWIAQIDGELGQKIGSIDSVLGNHNKDGKRLVRSRETNTGDFAADALYHLFLD
QGVDVAIMNGGGVRNNEITGELTYKKMKEIHTFGNVACLQRVTGQMLLDALEWGARNADA
DIAKENGGFLQVSGLKYEIHTYIASTVQKDEKGVWTGGPTGEYRVKNVQIFNRATNTWEA
LDLTKEYKLAGYNYTLRDLGDGFAMFKGAVNELDYVMQDYMVLANYVQSFENGHVTGYKN
IDGGDGRITFVFQKAPGTDSGPQTGDETAIGSYVVTSTVTLLALGACLALRRRKTQK

Enzyme Prediction     

No EC number prediction in MGYG000002724_00458.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09419	PRK09419	2.37e-134	2	1152	7	1147	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
COG0737	UshA	5.24e-69	5	547	2	503	2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family [Nucleotide transport and metabolism, Defense mechanisms].
COG0737	UshA	4.54e-64	622	1132	26	500	2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family [Nucleotide transport and metabolism, Defense mechanisms].
PRK09420	cpdB	9.51e-64	1	623	1	608	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
TIGR01390	CycNucDiestase	3.94e-62	38	623	6	585	2',3'-cyclic-nucleotide 2'-phosphodiesterase. 2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN98642.1	4.03e-118	618	1149	37	612
QRP42178.1	4.03e-118	618	1149	37	612
QJU22404.1	4.18e-116	618	1149	37	612
QIX91987.1	8.39e-113	618	1149	37	612
SET94084.1	1.97e-111	615	1149	29	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QFK_A	8.77e-34	36	551	21	489	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus NCTC 8325]
4Q7F_A	8.77e-34	36	551	21	489	ChainA, 5' nucleotidase family protein [Staphylococcus aureus subsp. aureus COL]
2Z1A_A	2.19e-32	623	1109	30	495	Crystalstructure of 5'-nucleotidase precursor from Thermus thermophilus HB8 [Thermus thermophilus HB8]
5H7W_A	5.89e-27	620	1128	2	509	Crystalstructure of 5'-nucleotidase from venom of Naja atra [Naja atra],5H7W_B Crystal structure of 5'-nucleotidase from venom of Naja atra [Naja atra]
3ZTV_A	1.57e-26	619	1115	9	536	Structureof Haemophilus influenzae NAD nucleotidase (NadN) [Haemophilus influenzae Rd KW20],3ZU0_A Structure of Haemophilus influenzae NAD nucleotidase (NadN) [Haemophilus influenzae Rd KW20],3ZU0_B Structure of Haemophilus influenzae NAD nucleotidase (NadN) [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34313	4.27e-79	20	1173	31	1198	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1
P08331	1.54e-41	30	623	19	606	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2
P44764	5.54e-41	29	613	28	606	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=cpdB PE=3 SV=1
P26265	1.58e-40	30	623	19	606	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=cpdB PE=3 SV=2
P53052	3.05e-39	22	623	16	611	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica OX=630 GN=cpdB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000310	0.998902	0.000215	0.000194	0.000190	0.000168

TMHMM  Annotations     

start	end
5	24
1168	1190