CAZyme Information: MGYG000002925_00028

Basic Information

• Species: CAG-877 sp900548695
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-877; CAG-877 sp900548695
• CAZyme ID: MGYG000002925_00028
• CAZy Family: CBM50
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290	MGYG000002925_1|CGC1	32624.05	5.5394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002925	1410926	MAG	United States	North America

• Gene Location: Start: 28409; End: 29281 Strand: -

Full Sequence      

MALNNIGAAGQKKRKVYQRRLPEDPSKDYYYIIRETSPMQSLLVEYGFIDNAADQKKLQN
NLEDYVEGVVKAIADYGGYKYTPPGSNTTEYVYTVVRGDTLSQIASKFNTTVEAIKRLNN
LTSDLLQIGQKLKIPTPTTLTETYTVQKGDTLYGIARKYNITVDELKSLNNIVGNNLYVG
QELRVPAIQTNDEYEIYTVVKGDSLWLISQRYDVTVDDLIEINNLENADLQIGDKLKIPK
TNSKKTYTVKKGDSLWSIAKEFNVSVEELKIANSLTSNLISVGQVLIIPQ

Enzyme Prediction     

No EC number prediction in MGYG000002925_00028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	144	186	1.8e-18	0.975
CBM50	247	289	4e-17	0.975
CBM50	93	135	1.2e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	4.94e-50	85	288	325	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	2.18e-18	146	236	348	444	membrane-bound lytic murein transglycosylase D; Provisional
PRK10783	mltD	2.43e-16	86	183	339	444	membrane-bound lytic murein transglycosylase D; Provisional
pfam01476	LysM	1.96e-15	93	135	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
pfam01476	LysM	2.10e-14	146	186	3	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR66034.1	7.49e-38	51	246	40	256
QVK20078.1	3.15e-35	9	187	112	285
ACL69398.1	3.82e-33	76	246	130	310
AGK52565.1	4.13e-32	92	239	107	261
QOY35011.1	2.29e-30	31	246	102	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	3.57e-16	80	240	32	218	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
4UZ2_A	1.34e-07	93	135	5	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	1.07e-06	93	135	5	47	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
5YZ6_A	3.35e-06	143	187	4	49	Solutionstructure of LysM domain from a chitinase derived from Volvox carteri [Volvox carteri f. nagariensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07532	2.86e-24	93	238	176	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
Q49UX4	1.87e-23	93	238	29	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
O31852	1.36e-22	82	238	79	268	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P54421	3.16e-19	95	246	30	200	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
P37710	1.75e-17	30	238	498	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002925_00028.