CAZyme Information: MGYG000002954_00109

Basic Information

• Species: UBA1191 sp900543485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; UBA1191; UBA1191 sp900543485
• CAZyme ID: MGYG000002954_00109
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
929		104758.8	4.6827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002954	2474898	MAG	United States	North America

• Gene Location: Start: 114622; End: 117411 Strand: +

Full Sequence      

MFSGDNKGKNTVDKPVTPHQENDVEPVTRDTISKEELMAQNEDARKIFEDIRSLRESVEA
LKGEDMDVLADSEPRQEPAKDLIIEDSDEILAAKQAIIEQARKDAEEERRKKEEARRKEL
AQMQARQEVLEAQKRAALIEEEAERKRRQAAEAERRAKAISRKQALDAMEAELQAKNEEL
AREEAATRETSGSTGQQAGIGGSRSADDRREATPEEKQAFFNEQPEDSDVREKTAVPSQE
VMRDLEDAKQELLMAQKQQGEVLGAISQIAEERTGKLAEEQQKKLDQQQTMLREEQEKLQ
QLLEAHRNERLERAEREKAERELKEQRAKVERLLKEERARAAREEKLARARKKREEKLHR
AEEKERQKRAKREAAEKARLEREQLKQKSIADAELGGGVVNVKGVKINTKIKDTLSVSLK
DFIGLADRQERKESSEEKAQQMKEEREKRREEAREAVELSVKQKLDEYEKSNFGKKMRSF
KDFCEKHKVSLLTSFSIFIMLLVGVAGVFNYYTAYAYSYNGQRLGLVKEKDDVLRITDLV
QSALTEDKNVDVVMDDIEFERVSALGDAEIDSSEDVLKRLSYMGNLNVKAYGIYVNGEKV
GAVENKDAAAQVLQDIKDRYSSGREGAEVEEAVFIENVDIRRSNTDLEDVLSEKEMVEKL
CTSGEKEVKHQVAAGETLADIAKLYSVTEEQLLEENPDIDQTKLEVGSVITFHQTAPILT
VRITEQVTYEQEIPYETEERDDPDMYQGDSETSQQGENGLEEVTSRIVLVNGEQVEETPL
VTTVKKEAVSEIIMVGSKERPPSVGSGNYIWPLSGGYTLTSNFGGRWGRAHEGIDLGVSV
GADVLAADGGIVTYAGYSGAYGYLVIIDHQNGMETRYAHNSSLLVSEGDEVFQGMHIAES
GNSGRSTGPHLHFEIRVNGVAKDPLNYLP

Enzyme Prediction     

No EC number prediction in MGYG000002954_00109.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0739	NlpD	2.50e-44	672	929	6	262	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].
pfam01551	Peptidase_M23	1.77e-43	829	924	1	96	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
cd12797	M23_peptidase	3.77e-38	831	915	1	85	M23 family metallopeptidase, also known as beta-lytic metallopeptidase, and similar proteins. This model describes the metallopeptidase M23 family, which includes beta-lytic metallopeptidase and lysostaphin. Members of this family are zinc endopeptidases that lyse bacterial cell wall peptidoglycans; they cleave either the N-acylmuramoyl-Ala bond between the cell wall peptidoglycan and the cross-linking peptide (e.g. beta-lytic endopeptidase) or a bond within the cross-linking peptide (e.g. stapholysin, and lysostaphin). Beta-lytic metallopeptidase, formerly known as beta-lytic protease, has a preference for cleavage of Gly-X bonds and favors hydrophobic or apolar residues on either side. It inhibits growth of sensitive organisms and may potentially serve as an antimicrobial agent. Lysostaphin, produced by Staphylococcus genus, cleaves pentaglycine cross-bridges of cell wall peptidoglycan, acting as autolysins to maintain cell wall metabolism or as toxins and weapons against competing strains. Staphylolysin (also known as LasA) is implicated in a range of processes related to Pseudomonas virulence, including stimulating shedding of the ectodomain of cell surface heparan sulphate proteoglycan syndecan-1, and elastin degradation in connective tissue. Its active site is less constricted and contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules, possibly contributing to its activity against a wider range of substrates than those used by related lytic enzymes, consistent with its multiple roles in Pseudomonas virulence. The family includes members that do not appear to have the conserved zinc-binding site and might be lipoproteins lacking proteolytic activity.
PRK11649	PRK11649	1.44e-23	811	925	286	407	putative peptidase; Provisional
PRK10871	nlpD	3.31e-20	795	929	181	317	murein hydrolase activator NlpD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI72223.1	2.20e-117	474	928	257	712
QAT41769.1	1.56e-112	481	928	181	629
QIB68001.1	6.45e-111	474	928	262	717
QOX64923.1	4.73e-95	481	928	486	933
AVM48688.1	8.05e-80	499	928	156	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3SLU_A	1.40e-16	829	926	244	340	Crystalstructure of NMB0315 [Neisseria meningitidis ATCC 13091],3SLU_B Crystal structure of NMB0315 [Neisseria meningitidis ATCC 13091]
6MUK_A	1.84e-16	829	926	264	360	1.93Angstrom Resolution Crystal Structure of Peptidase M23 from Neisseria gonorrhoeae. [Neisseria gonorrhoeae FA 1090]
5J1L_A	2.21e-15	831	927	65	163	Crystalstructure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1L_C Crystal structure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1M_A Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695],5J1M_C Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695]
5KVP_A	9.77e-15	805	915	11	125	Solutionstructure of the catalytic domain of zoocin A [Streptococcus equi subsp. zooepidemicus]
6UE4_A	4.20e-13	811	919	239	354	ShyAEndopeptidase from Vibrio cholerae (Closed form) [Vibrio cholerae O1 biovar El Tor str. N16961],6UE4_B ShyA Endopeptidase from Vibrio cholerae (Closed form) [Vibrio cholerae O1 biovar El Tor str. N16961]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45682	1.38e-18	807	929	176	295	Lipoprotein NlpD/LppB homolog OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3623 PE=3 SV=1
P0AFS9	1.37e-16	811	925	287	408	Murein DD-endopeptidase MepM OS=Escherichia coli (strain K12) OX=83333 GN=mepM PE=1 SV=1
P0AFT0	1.37e-16	811	925	287	408	Murein DD-endopeptidase MepM OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mepM PE=3 SV=1
P0AFT1	1.37e-16	811	925	287	408	Murein DD-endopeptidase MepM OS=Shigella flexneri OX=623 GN=mepM PE=3 SV=1
Q56131	1.42e-14	811	929	256	371	Murein hydrolase activator NlpD OS=Salmonella typhi OX=90370 GN=nlpD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
491	513