CAZyme Information: MGYG000003118_00126

Basic Information

• Species: Haemophilus_D parainfluenzae_J
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_J
• CAZyme ID: MGYG000003118_00126
• CAZy Family: CBM50
• CAZyme Description: 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000003118_1|CGC2	72696.98	5.7944

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003118	1969878	MAG	United States	North America

• Gene Location: Start: 130077; End: 132050 Strand: +

Full Sequence      

MINRRDFIQLGASSILALSASRFAFAKGDTQVDLRIVATTDIHSFLTDFDYYKDAPTEKF
GFTRAASLIRQARQEVKNSVLVDNGDLIQGNPIADYQAAKGYKEGKSNPAVDCLNAMHYE
VGTLGNHEFNYGLDYLADAIKQAKFPIINANVVKVGTEEPYFTPYVIQTKEVVDSQGKMH
KLNIGYIGFVPPQIMVWDKANLQGKVETRDIVKTAQKYVPEMKQKGADIIVALAHTGPSD
EPYQEGAENSAFYLADVPHIDAIVFGHSHRLFPNKEFAKSPNADIAKGTVKGVPESMAGY
WANNISVIDLTLAQHNGKWLVADGKAALRPIYDAENKKATTESDAELTALLKPVHEATRE
FVAQPIGKATDNMYSYLALVQDDPTIQIVNQAQKAYVEKVAPSVAAMAGLPILSAGAPFK
AGGRKNDPTGYTEVNKGELTFRNAADLYLYPNTLIVVKATGEELKEWLECSAGMFKQIDP
TSDKPQSLLDWEGFRTYNYDVIDGVNYEFDLTQPARYDGECKLINPNSHRVVNLTYQGKP
VDPKAEFLIATNNYRAYGNKFPGTGDAHIVYASPDENRQILADYIKAESEKHGHVNPSAD
KNWRFAPIKGNDKLDVRFETSPSEQAAKFIQDNAQYPMKKVGTDEVGFAVYQIDLSK

Enzyme Prediction     

No EC number prediction in MGYG000003118_00126.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11907	PRK11907	0.0	32	652	114	722	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK09420	cpdB	0.0	8	657	1	649	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK09419	PRK09419	0.0	32	655	40	647	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
PRK09418	PRK09418	0.0	28	657	34	654	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
TIGR01390	CycNucDiestase	0.0	32	657	1	626	2',3'-cyclic-nucleotide 2'-phosphodiesterase. 2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANF95373.1	2.00e-222	26	657	35	666
ANY70674.1	3.73e-215	16	656	22	656
QJD88116.1	2.16e-214	13	657	13	656
AYQ74930.1	3.97e-211	14	655	20	662
QOS76560.1	8.69e-210	26	656	30	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JYF_A	9.44e-141	32	364	7	339	ChainA, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578],3JYF_B Chain B, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
5EQV_A	4.62e-133	32	364	8	340	1.45Angstrom Crystal Structure of Bifunctional 2',3'-cyclic Nucleotide 2'-phosphodiesterase/3'-Nucleotidase Periplasmic Precursor Protein from Yersinia pestis with Phosphate bound to the Active site [Yersinia pestis CO92]
3GVE_A	1.97e-97	31	362	9	339	Crystalstructure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GVE_B Crystal structure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3QFK_A	2.65e-37	33	585	19	509	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus NCTC 8325]
4Q7F_A	2.65e-37	33	585	19	509	ChainA, 5' nucleotidase family protein [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44764	0.0	1	657	1	657	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=cpdB PE=3 SV=1
P08331	1.27e-314	18	657	8	647	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2
P26265	2.81e-311	18	657	8	647	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=cpdB PE=3 SV=2
P53052	4.29e-295	16	657	8	652	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica OX=630 GN=cpdB PE=3 SV=1
O34313	3.41e-183	31	653	42	651	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	0.000000	0.999974	0.000014	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003118_00126.