CAZyme Information: MGYG000003675_00157

Basic Information

• Species: Faecalibacterium sp900551435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900551435
• CAZyme ID: MGYG000003675_00157
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		69834.15	8.5475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003675	2696714	MAG	Peru	South America

• Gene Location: Start: 17053; End: 18942 Strand: -

Full Sequence      

MIEEKTKEPRQEAPSAPPVKRGQKLRSRWAQFQCSRLLRKHRFRRRTQYHMNNLSQKLRG
SAVVLTVGEALYALGFAAEYTVVRAGRNVAALLRWLWHGIRNVLHEVAVMAFPGAAQMFK
DLFGPVFLFFRGIGSLLVHARNVRKKQGFGAAIKASAHFFADGIRRNMKLLPRMAMYVLP
ACMLAVFVTVYNQTIQKPYALAVQVNGQTVGYVANEEVFNLAREDVMERINYAGTDKTEW
TIEPTYTISVAHQTMDESQTADAILKSASDEISEGTALYLDGELTAVCSNGDALRSYLDQ
MLEPYEQEYLGDENVTVGFNKSVLLEDGIYFNDSFEDDNSIESMLTGVQQQEKVYTVQAG
DTLWAIAQKNDLTFKELCALNTNFKGAALTETSNIQEGDQLIVTKEEATLEVRITKIETR
QEEIPFTTETTRSNEYTKGTTKTLQEGENGLRMVTLQNVYDTNGTLLEQTVLSTQTIKEA
VPKKVVVGTKKVTNSTQYITGSGQFIWPVPNYRYCSRWYGSGHKGVDICAPAGTPIYASA
SGKVTKAGYERGGAGTGYGYSVIISHSGGYTTVYAHCLSLTVSAGQSVRQGQLIGYVGST
GRSSGNHCHFEIRRNGSYLAPQNFFPGKR

Enzyme Prediction     

No EC number prediction in MGYG000003675_00157.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0739	NlpD	1.36e-43	353	629	2	265	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].
pfam01551	Peptidase_M23	2.88e-43	521	621	1	96	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
cd12797	M23_peptidase	1.16e-38	523	612	1	85	M23 family metallopeptidase, also known as beta-lytic metallopeptidase, and similar proteins. This model describes the metallopeptidase M23 family, which includes beta-lytic metallopeptidase and lysostaphin. Members of this family are zinc endopeptidases that lyse bacterial cell wall peptidoglycans; they cleave either the N-acylmuramoyl-Ala bond between the cell wall peptidoglycan and the cross-linking peptide (e.g. beta-lytic endopeptidase) or a bond within the cross-linking peptide (e.g. stapholysin, and lysostaphin). Beta-lytic metallopeptidase, formerly known as beta-lytic protease, has a preference for cleavage of Gly-X bonds and favors hydrophobic or apolar residues on either side. It inhibits growth of sensitive organisms and may potentially serve as an antimicrobial agent. Lysostaphin, produced by Staphylococcus genus, cleaves pentaglycine cross-bridges of cell wall peptidoglycan, acting as autolysins to maintain cell wall metabolism or as toxins and weapons against competing strains. Staphylolysin (also known as LasA) is implicated in a range of processes related to Pseudomonas virulence, including stimulating shedding of the ectodomain of cell surface heparan sulphate proteoglycan syndecan-1, and elastin degradation in connective tissue. Its active site is less constricted and contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules, possibly contributing to its activity against a wider range of substrates than those used by related lytic enzymes, consistent with its multiple roles in Pseudomonas virulence. The family includes members that do not appear to have the conserved zinc-binding site and might be lipoproteins lacking proteolytic activity.
COG4942	EnvC	1.60e-20	495	622	287	415	Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning].
PRK10871	nlpD	1.85e-18	355	626	63	317	murein hydrolase activator NlpD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATL90987.1	0.0	1	629	1	628
QIA43491.1	0.0	1	629	1	628
ATP00785.1	0.0	1	629	1	628
AXA82717.1	2.15e-298	1	629	1	630
AXB28979.1	9.25e-272	1	625	13	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3SLU_A	5.57e-18	523	621	246	338	Crystalstructure of NMB0315 [Neisseria meningitidis ATCC 13091],3SLU_B Crystal structure of NMB0315 [Neisseria meningitidis ATCC 13091]
6MUK_A	7.38e-18	523	621	266	358	1.93Angstrom Resolution Crystal Structure of Peptidase M23 from Neisseria gonorrhoeae. [Neisseria gonorrhoeae FA 1090]
5J1L_A	2.59e-17	523	624	65	163	Crystalstructure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1L_C Crystal structure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1M_A Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695],5J1M_C Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695]
5KVP_A	7.21e-16	522	612	33	125	Solutionstructure of the catalytic domain of zoocin A [Streptococcus equi subsp. zooepidemicus]
5J1L_B	2.65e-15	524	624	47	144	Crystalstructure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1L_D Crystal structure of Csd1-Csd2 dimer I [Helicobacter pylori 26695],5J1M_B Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695],5J1M_D Crystal structure of Csd1-Csd2 dimer II [Helicobacter pylori 26695]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46798	2.78e-16	522	626	144	243	Uncharacterized lipoprotein YgeR OS=Escherichia coli (strain K12) OX=83333 GN=ygeR PE=3 SV=2
O64046	1.08e-15	521	627	1578	1680	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.08e-15	521	627	1578	1680	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P44693	8.35e-15	523	621	348	442	Uncharacterized metalloprotease HI_0409 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0409 PE=3 SV=1
P0AFT0	8.93e-13	523	621	314	407	Murein DD-endopeptidase MepM OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mepM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
61	83
122	139
170	192