CAZyme Information: MGYG000004261_00451

Basic Information

• Species: UMGS1449 sp900551925
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS1449; UMGS1449 sp900551925
• CAZyme ID: MGYG000004261_00451
• CAZy Family: CBM50
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		42695.78	4.2955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004261	785527	MAG	China	Asia

• Gene Location: Start: 3776; End: 4945 Strand: -

Full Sequence      

MVIDAGHGGEDSGNTGNGLIEKDYALLISNYIKERLDDLGITNIVTRSTDRDLSIEERID
IIRNAYGIDNNVLVISNHLNKGGEEGLEVIYALRDDDSLAEEIAKQVTSAGGVVNKYYQL
RDPDDTQYDYYPLIRDTPDYETVMIEYAYVDNSADATRIKDNYQDYAEAVVRAIALYTGN
QYVPLPGDEYYVVKAGDSLWKIANSYGISVDELKKANNLSTNLLQIGQLLFIPGLEESEE
EVLENTYTVRSGYSLWKIANSYGISVADLKSYNNLSTDLLSIGQVLKIPSASSTVYTVKA
GDSLWKIANNYGISVEALKKANNLSSDLLQIGQTLKIPGGSSTVYTVKAGDSLWKIANSY
GISVEALKKANNLSTDLLSIGQVLKIPLS

Enzyme Prediction     

No EC number prediction in MGYG000004261_00451.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	296	338	2.7e-18	0.975
CBM50	345	387	6.8e-18	0.975
CBM50	191	233	9.2e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	2.12e-48	190	386	333	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	3.47e-41	246	386	332	523	1,4-beta-N-acetylmuramoylhydrolase.
cd02696	MurNAc-LAA	2.11e-33	2	175	3	172	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
pfam01520	Amidase_3	1.10e-29	2	174	2	172	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
PRK06347	PRK06347	1.90e-25	290	386	327	449	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVK20078.1	7.77e-53	1	289	2	284
QIC05530.1	9.36e-33	1	187	85	265
AGR47373.1	5.18e-32	1	187	158	338
AUM64330.1	1.79e-30	1	217	157	366
AYB39952.1	3.41e-29	1	187	157	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J72_A	1.73e-10	1	159	454	616	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
2MKX_A	9.57e-08	247	292	7	52	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]
5EMI_A	2.66e-07	1	177	7	177	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
4B8V_A	1.17e-06	185	295	113	223	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
4UZ2_A	1.27e-06	187	238	1	52	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54421	4.30e-20	191	294	88	198	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
O07532	2.00e-19	193	294	31	141	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O31852	3.62e-18	191	294	159	274	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
P54525	3.66e-15	1	177	32	203	Uncharacterized protein YqiI OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiI PE=3 SV=3
P0C2T5	6.72e-15	191	294	245	368	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004261_00451.