CAZyme Information: MGYG000004508_00761

Basic Information

• Species: UMGS2068 sp900769635
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; UMGS2068; UMGS2068 sp900769635
• CAZyme ID: MGYG000004508_00761
• CAZy Family: CBM50
• CAZyme Description: Cell division suppressor protein YneA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000004508_24|CGC1	37314.27	9.8943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004508	947290	MAG	Israel	Asia

• Gene Location: Start: 1170; End: 2189 Strand: -

Full Sequence      

MKVIIDPARGGNDTGVSGGGITEKDWNLAISKYIYNILKNKGIDVYLTRTEDVDIPEAER
ATKIKNYATTSNDIIVISNRLNEGKDDGAEIIYPLRSTNNLAKALATALESTGQNVNKYY
QRRLPSDLASDYDYIIRNTSPYETIIIKYGYVDSPEDDITQLKNYQSLGNAIANTIISRA
SSSGTYTVKKGDTLYSIAKKYNTTVNNIKSLNNLSSNTLRIGQKLKIPLKETTTPSTTPT
PNTLTYTIKKGDTLYGIATKYSTTISAIKSLNNLDTNTLTIGKTLKIPTTTSYTTHTIKK
GDTLYSIAKKYNTTVNNLINLNNLKTTTLSIGQTLKVPL

Enzyme Prediction     

No EC number prediction in MGYG000004508_00761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	186	228	1.4e-18	0.975
CBM50	296	338	7.4e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02696	MurNAc-LAA	2.28e-26	2	177	1	172	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
pfam01520	Amidase_3	3.56e-24	3	176	1	172	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.
PRK06347	PRK06347	1.00e-21	178	337	400	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	4.05e-21	164	337	311	523	1,4-beta-N-acetylmuramoylhydrolase.
COG0860	AmiC	2.98e-20	1	178	43	226	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVK20078.1	8.64e-39	3	288	2	284
QIC05530.1	8.96e-26	3	172	85	248
AGY48195.1	6.59e-25	2	287	3	302
AGE61023.1	2.42e-24	2	287	3	302
AYB39952.1	2.58e-24	3	172	157	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EMI_A	1.03e-08	1	177	5	175	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]
4UZ2_A	6.52e-08	185	233	4	52	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	5.93e-07	185	233	4	52	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54421	1.01e-16	172	292	14	134	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
Q49UX4	8.08e-16	170	287	13	129	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
O31852	5.28e-14	172	292	15	136	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
Q8CMN2	3.46e-13	178	288	75	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	3.46e-13	178	288	75	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004508_00761.