CAZyme Information: MGYG000002694_00267

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000002694_00267
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959		103484.83	4.3529

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002694	2309879	MAG	Canada	North America

• Gene Location: Start: 2657; End: 5536 Strand: +

Full Sequence      

MFTLSEEETPVKARSRRRLGILVAVLAVVLLAAAGFAAYFLTRDKGIGDYVVREESSVRI
ASPGGNTVLVLTTADGQLRYQVERDGRPFTEAGALGVTVDSVAYGAADSVEQLGKITGEV
RTDKRTINGRMKEAAEPCVSAVVPVNTQGKEFTLEVRVFDNGAAFRYRLPGEGNRVVKSE
QTSFALPAGSMLWASDTHVYYESKVEKRDPSKESDQTLATPATVQLPDGGYAAILEGNLG
NYAGMSLAWRGENQYGADFTHGNAATFVLSGEIVTPWRIVAVADDLDQLVNNTIVYQVCD
APEESLFDGGWIKPGRAVWSWITGRTSDRVTPEIMEAYTEDAAVLGFEYNLIDEGWVHWE
DYESVLRSLADQGAPYGVGQILWTGVTAGAGYGNGIKDFADARRYLDFLSDTGMKGGKID
FFTTETSVEMGVDIYREILQYAAEKQLLINFHGCNKPTGLDATWPNELNREAILGLESTQ
VTNRNAQAQMFTTQVFTRNLAGHADYTPAVDTAFHMAQLVLTDAPLQAIGTSTETLLSLP
SLEMIKSVPTVWDRTVVLPQSAIGEAAVYARESAGGSWFVGGINYRSPDSATMLELSRFL
GEGSYRMELWTDGKDGLEKQTRTVTREDTVEVPFDKLSGFIARFDRVALSQYGGEILFGT
PVTVEVPDPATVAAYTLDGSEPDASSPRVENGTAIELTDSAVLTVKILDGPGKGRVQSYR
FNRIATPRVRVVSEQDEGGTATVTLKPNFDAPLHYTTDGSLPDAGSPVYEGPFLMEHSGL
LQLYAETGDTPFRMSQYIESAPAIEVNPELALTDAEWLSATTGYAGDPATKDRNTKGRTI
AIAGTRYSRGLGTNAIGTFEYAVPENADRFVAVCGIDDGIRSDGNYTLASATVSVSFSGG
GLEGNSLPYTTPVFVYGEKLVIDLPVPEGAEKILITCGDAGDGIVCDNVSIGNPGWMLK

Enzyme Prediction     

No EC number prediction in MGYG000002694_00267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	56	644	1e-115	0.9793977812995246
CBM51	812	953	1.4e-19	0.9552238805970149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	5.10e-44	62	300	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	1.86e-38	311	549	4	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam08305	NPCBM	4.13e-20	812	954	5	133	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
smart00776	NPCBM	8.27e-13	808	954	3	142	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.
pfam13290	CHB_HEX_C_1	3.18e-05	739	785	8	55	Chitobiase/beta-hexosaminidase C-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXY78499.1	5.45e-104	58	646	26	627
QNK61828.1	8.03e-104	53	646	34	629
QNE39615.1	3.01e-93	50	646	21	620
AGA29066.1	3.02e-93	58	644	31	631
BCG54503.1	2.61e-92	59	647	23	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XFM_A	1.34e-40	80	628	40	625	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3A24_A	1.91e-35	62	613	6	603	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.60e-34	62	613	20	617	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	8.46e-50	61	642	42	618	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	1.66e-35	52	613	17	624	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999997	0.000040	0.000001	0.000000	0.000000	0.000009

TMHMM  Annotations     

start	end
19	41