CAZyme Information: MGYG000000429_00099

Basic Information

• Species: UBA7597 sp900542935
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA7597; UBA7597 sp900542935
• CAZyme ID: MGYG000000429_00099
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909		102458	5.0301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000429	1972857	MAG	Sweden	Europe

• Gene Location: Start: 123756; End: 126485 Strand: +

Full Sequence      

MTENEKKNERNVMSGAEFISATECYLSAPESMPSSVLPLGDWISPVQYTRYYLRREVFLE
KPVAVAELEFQSSLPADIFLGDEEIGMQKQDGWYLTGVHNVTTAVRRGVNYLSVRGFLSD
NPEHFIIGVRGCLKVTYTDGETELFDTSDGFKNYGMCGFWENAETPGWQTTPLTEERAMN
QSRLHPRLRVRAVYLKGEFETEKPVKKAVLYATAKGLYVPYLNGRRVSDARFLPGSAEGV
TEYRAFDVTEFLLGGKNVLGAELGSGFYNSESWGSFYNRIPALMMRLEIEYRDGETYDFC
TDKNWRVHASPRTENDIQFGERYDARQENGNPFAGAADETWGYAEERRFEEKPFAAQNYP
PVRIKSVVSAKKMFTLADGSVCYDFGTNSSGRVKLTLKNTVRGERVLIRYCEETELSERG
CEANVTEYGDVFFYGDTLATGRACYGARNIDLYICRGDAEETYIPEFTFTGFRYVYVSGY
SGVYGKDAVQKAEMYSDLAQTGVFKAGHAGLKRIFDAVMRSYRSNTVTAPTDCPTREKNF
WNGDLQAFINTACWYTDNNLFLERWTEAGRKMGGDDTYGWGDEDYVTPLTLYRFYENTDV
VLSKYEKVRKLISVRKKQVAPGDVLPSVNTVTYGDHKAGKRVPDDFFCAAYYCRMFACAA
RMAEIAGKTQDAATYRDEFEKARKAFNAKYYLPEKHDYTPGNQGGIVYPVAFGIAEPQEI
QSLADTLHGYVVADGYRFQTGFMSTEFIPGILCDNGYAADALKMMTNKEYPSLLNMIDTA
GCGTTTESWEARVGRGDSLNHYAVGNATRWFFEYLGGIKPVKAGFEEIVIKPYFFKELKN
AYVSYKSVRGTIVSAWEYNEEDDTFTWTVTIPEGIAARIELPHGMRRTGGAEIGAAQSGT
MTTIVSEIS

Enzyme Prediction     

No EC number prediction in MGYG000000429_00099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	375	881	2e-110	0.9940476190476191
CBM67	189	346	5.1e-29	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.24e-50	499	815	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.18e-33	203	365	1	171	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.13e-15	817	896	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.65e-11	375	482	2	89	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94338.1	2.24e-147	18	882	101	974
AQS56111.1	2.79e-85	29	882	101	973
ATQ42417.1	2.98e-85	192	894	324	1034
QMW65243.1	4.32e-85	133	882	250	998
AHM61167.1	9.22e-85	192	882	168	878

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	2.74e-79	16	882	120	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	3.48e-66	199	887	183	904	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	6.61e-60	191	882	130	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.29e-78	16	882	120	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	5.49e-60	191	882	173	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	2.47e-58	192	881	184	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	1.94e-54	194	882	172	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000429_00099.