CAZyme Information: MGYG000002383_00123

Basic Information

• Species: Lacticaseibacillus zeae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus zeae
• CAZyme ID: MGYG000002383_00123
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
912	MGYG000002383_5|CGC1	102456.83	5.1834

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002383	3001027	Isolate	Italy	Europe

• Gene Location: Start: 124064; End: 126802 Strand: -

Full Sequence      

MSNITAALYAPDHLSVNLQHFAYNVQQHPRFSWWNHSSFSDASQAAYQLVVFKRLQDRDH
QTYLYDSGWVHSAQNTAITAADLADSLHPGDLYYWQVRIKDNLGHTSDFSQPAKFICADP
ALPVQQGIWRQSQPKSGEELAHIGNVVFLRSPQLTIDTNDVDTAVVVAFARGNEPIFAQS
FDLYVNGHCLGVGSARQQEHDHGTDRTAVYYNVYDATDYLENGINTIAALATGSSDRRAF
WCQLIVYKHDGTKEVVTTADPSWRALDGSSAFGDFGVKIRSQYFGMVSENIDMRYYPQNW
ASKTFDDHDWPAAWRNPQPMIVDDEVLVPYRSENTERIEVHDANKRIVTFSPQNRLIDLG
KEIIGGLTVDLASDTDQRVTVLMGEQLEDNGHVRHDMACGPDYVENWTLVKGENHFTTLQ
MKNFRYVELLGFEGDLHLDAINGWAMQQRFPDNEGNFQSDSDLLNREYELSKYTIKATNQ
DVFVDSQARERRPYEGDLLVNANTSYTVSANYSLARHSLDYLIDNPTWPEDYKLFAIEMA
WLDFLYTGDDTLLKTRYTALQYKLNRGKSAESFDGASQSFKGSLKNSKGVDNFDEKVGLV
TNDGLVDWPISERDGFVEGTYNTPFNAIFYGAYSTMAKIAKVLHHDDDAAHYQDRAATIK
KNLIDKLYDDQTGRFFDSLNADQTINRHTSHHASAYALCYGVYTDQAMADRLSQFVANNG
QFVGSIYFIYFMLKGLFESGHAADAITLLTDPNDQKDHKSFAAILDSLKATIAPEAWSNH
YKPNLTLSHPWGATPGLTIVQGIAGIMPIEPGFSTFRIKVRAGNLTHLNLTTPSVKGLIT
VHYQQDAGNQALEVAVPMNAKAQVELPAQAQQVAVQDQFGKDWTTAVQHDDQTLTIPAGS
YRITYQQGTVGK

Enzyme Prediction     

No EC number prediction in MGYG000002383_00123.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	349	866	8.6e-105	0.9940476190476191
CBM67	179	313	7.6e-23	0.7102272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	9.04e-26	455	796	4	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.12e-16	181	319	16	156	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.11e-07	805	867	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	7.86e-05	356	446	9	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVI31545.1	0.0	1	912	1	912
ARY92375.1	0.0	1	912	1	912
QVI36998.1	0.0	1	912	1	912
QXG58789.1	0.0	1	912	1	912
QPB48579.1	0.0	1	906	1	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.13e-17	26	867	48	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	1.14e-10	356	867	440	942	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	3.17e-64	284	866	541	1136	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KPL4	3.81e-20	29	907	51	951	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000042	0.000009	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002383_00123.