CAZyme Information: MGYG000002984_00289

Basic Information

• Species: UBA737 sp900554525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737; UBA737 sp900554525
• CAZyme ID: MGYG000002984_00289
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000002984_19|CGC1	81673.95	5.1157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002984	1653947	MAG	United States	North America

• Gene Location: Start: 6343; End: 8508 Strand: -

Full Sequence      

MIKKADWIKSSVNFGNACSVLKKEFNLSKKVKTATLSISALGMYEAYINGRRVGDFVFAP
GWTSYDNRVQYQEYDVTDLIENRNTLSVTLGRGWCFSRLSWNEDYFRPYKYSSPAIICAL
KIVFTDGTEQTIYSDESFTASKSGILYSEIYDGETFDANVTQESWVKTEKCDYSKDILVP
QQGEHICEIEEISPKALITTPKGEKVIDFGQNMVGYVRFQVNAPAGTVIELSHAEVLDAD
GNFYTDNLRTAKQTIKYITDGKQSEYKPHFTFQGFRYIRISGWYGDINEDDFRAVVIHSD
IKCTGYFECSNAKVNKLFSNILWGQKGNFLDVPTDCPQRDERLGWTGDAQVFVRTATFNY
DVLKFFTKWLTDMKLEQFANGGIPAVVPDVIGGNESSSSAWGDAAVICPWQLYLTYGDKK
ILADQFDCMKKWVDYIRGQGDDEFLWNTGHHYGDHLSLDKTVTSKDLIATAFFAYSTKLL
IKSGNILGKDMTAYESLYGHIVSAFRENFIKNGRLVSNTQTAHAIALYFDLCGEYKENIA
KNLARLITDNGNRLTTGFVGTPYLLHALSQNGYAEIAYNLLLQEEFPSWLYSVNKGATTI
WEHWDGIKEDGSFWCADMNSFNHYAYGAVADWMYGAVCGINIDENAPGFENAILKPIADK
RLHFAKASISTKYGILSSEWNINGDTIQYRFEVPNRAEIVLNGNTYEVEKGIHTFEFKMC
E

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	199	698	1.1e-169	0.9841269841269841
CBM67	6	169	6.8e-25	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.11e-143	304	637	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.67e-47	29	190	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.69e-38	198	298	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.35e-11	642	716	2	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97594.1	6.14e-267	4	701	116	837
AUS97620.1	4.96e-266	5	716	117	863
QCT01496.1	4.29e-260	5	703	118	842
AHF25954.1	9.68e-258	2	715	12	726
QBE96651.1	2.94e-256	5	715	5	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	3.91e-159	16	680	300	971	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.78e-158	22	718	135	866	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	4.83e-122	20	698	178	893	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	8.71e-07	204	362	438	590	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	5.06e-164	21	694	177	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.55e-158	16	680	300	971	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.13e-136	21	694	173	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	8.83e-91	15	707	181	922	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002984_00289.