CAZyme Information: MGYG000003504_00451

Basic Information

• Species: CAG-1435 sp003537755
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-314; CAG-1435; CAG-1435 sp003537755
• CAZyme ID: MGYG000003504_00451
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	MGYG000003504_28|CGC1	96630.87	7.9316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003504	2246614	MAG	Fiji	Oceania

• Gene Location: Start: 9124; End: 11682 Strand: -

Full Sequence      

MKAINLKTEYLVNPMGIDIQNPRLMWNCEGGIKQTAFRIIAKSDRKIVWDSGKVLSSSMH
ADYPLTLASRGRIEWSVTLWDENDLEGEPSETAYFETGLLAASDFTAKWISGNYRVNKKK
RYPVDCFKKQFAAQNIAKARLYITACGLYEAKINGQRVGNFVLAPGHTDYTKRIQLQTYD
VAKLLKNGENDITVELADGWYRGSCGAWGLKNQYGTQTKLYAQLEITDKTGKVTIVGTDK
TWAWSDDGKIRFADNKDGEVVEAWRVPSYSGFAKETKCDVMPVSSNNVPVTEHERFTVKQ
VVTTPGGAKVLDFGQNIAGYISFAVMAKRGQKIKLRFGEMFDENGEFTQKNFQCANKKRT
KVTPLQQIEYFCKDGLNEYKTKFAIFGFQYVLIESDAEWKKEDFTAIAVYSDMEKTLSFD
SSNELLNKLVEATRWSAKNNHADVPTDCPTRERHGWTGDAQIFCNTASYLFNFAPFARKY
VSDMVDGQRKNGKFRQITPKGGVDFYMDFMDGSAGWSDAGVLIPYRIYKRYGDKKILESS
YAAMKKYADFKIKTLGKWYPTAIGTGIDRKYKKYISNYGQSYGEWAEPTEVHITGFKDFA
CPHPEETTAYIVYMLQTMSEIAEVLGKTDDKKRFSEYAEKAKIGYNKLLECPEFSLDTDR
QAKLVRPLYMNLLNEEQSKFAENRLVAALDKYDWRLGTGFLSTPFILYVLEKIDVEYAYK
LLENEQMPGWLFMPKMHANTIWESWEGTEAQGGIASLDHYSKGAVCEWLFGDMCGIKVSG
ENEFTIAPKAGGKFTFAGCEYQSVYGKVSCGWERQKGKTTYKIVIPANTTAKVILPGGEK
TLTAGEYEFAEE

Enzyme Prediction     

No EC number prediction in MGYG000003504_00451.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	302	835	3.3e-133	0.996031746031746
CBM67	107	263	7.3e-25	0.8181818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.56e-85	414	770	1	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.75e-43	136	267	3	134	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.15e-18	303	410	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.15e-16	783	846	11	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFJ55302.1	0.0	1	848	1	862
AHF25263.1	0.0	1	845	1	840
QUC03017.1	0.0	1	849	1	880
AWI66986.1	1.02e-268	1	850	7	860
ADP81465.1	1.18e-264	1	849	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.31e-104	5	836	34	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.57e-100	65	836	242	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.03e-94	15	849	16	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.79e-113	8	836	41	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.57e-99	65	836	242	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.14e-99	2	849	30	908	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.40e-72	13	839	42	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003504_00451.