CAZyme Information: MGYG000004082_00102

Basic Information

• Species: AM51-8 sp900761925
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp900761925
• CAZyme ID: MGYG000004082_00102
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848		96221.82	5.1014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004082	2757417	MAG	United Kingdom	Europe

• Gene Location: Start: 3267; End: 5813 Strand: +

Full Sequence      

MEMRAYHLQVNHLSRPVGIDGGNLRVSWRLEGGIRQSAYQVEVKTKNGELLETTGKVSSH
DMFCRLKKRIPWRSRAQIVLRIWDESGKEGQGATLDVMTGIEREAWKALWINPELTCDPK
ERKPGSYLRKKFDVQDPGDAVLYITSHGICNVYLNGREAADLQLMPGTTQENRRLMVETL
DVTPFLQTGENEIVVTLGDGWHRGSMGYDQNRNVYGTDVALLCQLEVDREPVLVTDETWE
ASNDGPLGRNDLMAGEEYDATRAETMTYHGVKREDFGYDNLICVDTVPILPKEVFAAKLI
ITPKGEKVLDFGQNLVGYVRLDLEAKAGQTITLTHGETLDGDGNFTIENFQAPKVRTEQK
VVYRCREGRNLYHPTKTYMGFRYVLVEADFDVDPADFQAVAIYSDMLTTGEFSCGVPEVN
QLFRNALWSMKGNFIDVPTDCPTREKSGYSGDCQAYIRTAMYLMDCYPVYAKWIREQAAT
QTPEGCVAQIAPMNSRKQSNPDGGIGWCDSFEIVPYYLEKRYDDHTLTEEFYGQIADWMR
FQIKKSRKLRLANRRKVPKELRSYLLDNGWLWGEWLEPGQDVVPYMVNLMTHGDLELSSS
YLSYGCALVAEMAESLGKSEDAAYFREVSGKAKEAYRYLFLKNGKIEEPKRQCRYVRPIA
LGMLTEEEKPRTAESLAEKIAENGGKLNTGFLTTHELCRVLTENGQAKTAYDLLLQREAP
GWLYSVLQGATTIPENWYAYGEDGSRKDSFNHYSYGAIAGWLMDCVCGIRVEDGRLRIHP
YPDRRLGYAKGIYDSPLGKVSSGWEYTQDGIRFSFVIPSNSRAVVTLPDGERELEPGEYT
FLFPDEAK

Enzyme Prediction     

No EC number prediction in MGYG000004082_00102.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	302	827	6.9e-130	0.9920634920634921
CBM67	118	263	5.2e-20	0.7784090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.12e-90	409	766	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.44e-33	136	263	2	133	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.92e-20	302	403	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.84e-13	768	838	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30263.1	8.78e-247	253	839	1	605
QTE67956.1	1.60e-235	105	841	10	749
AXB29247.1	1.25e-232	3	839	1	869
CBL02680.1	1.77e-232	3	839	1	869
AHF25957.1	1.56e-227	13	819	1	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	1.84e-95	12	828	11	847	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.60e-85	140	828	319	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	5.66e-74	6	828	33	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	5.30e-110	5	833	35	884	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.88e-86	16	828	43	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	7.41e-85	140	828	319	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	1.27e-58	10	833	37	912	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004082_00102.