CAZyme Information: MGYG000001435_00307

Basic Information

• Species: Corynebacterium amycolatum_A
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium amycolatum_A
• CAZyme ID: MGYG000001435_00307
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
703		75692.67	4.9739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001435	2471632	Isolate	not provided	not provided

• Gene Location: Start: 355519; End: 357630 Strand: -

Full Sequence      

MRVTARFLRGGLGNSRKSSRALTALLALPLTLALGAPAAVAAPEPAQPGLPSYEELQAVQ
GQLAQSGDLGDLAKAAEAAQAAGAQLPGLGMPKPMPGPERTPFKVDTPAVANLPSGVSVD
KVEWYTDHHVIAHIRSAAMPEKPIQVEILLPRDWYRDKERTFPSVYHLDGMASFDDYSGW
IRATNIERFYEDKNVLVVMPAGGTSSFYSDWDQPDNGQNYKWESFITKELVPVITNGFRG
NDERGIIGISMGATGAYNVAAHSPELWKFAGSLSGYLDMTSPGMPQAIALAMKNTGGYDA
TKMWGPLGSQRWKDNDPKLNIDKLKGMSLYISAGNGNTGEWDVPSQINPTKPDNPTGYAL
EVLSRMTSETFIRNAREKGVEPVVNFRSSGTHTWPYWQFEVSQAWPTLADALQLPESDRG
AVCRVGGEIEKAVASLPGIGTCLSDEYGVAKNGVAQDFTGGTAYWHPDSGAHVVWGRIGS
RYNELGGPSSPLGYPVTNELATPDGSGRFVHFEKGSIYWTPEGGAHEVTGDIMNVWGKAG
FETGPLGYPVANHRDIPGGVAQDFQGGTIVKIGGEEPRIVRGEIGRVYKELGGAESDLGL
PVDGDEVKLARGAFQRFEHGAIYWTPETGAQPVRSNDITDHWGSTGYENGPFGYPVGPLQ
PVKAGGLEQQFEGGWIRQLNGKIVEERNKPEAPAPAADNGDDK

Enzyme Prediction     

No EC number prediction in MGYG000001435_00307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	138	410	1.1e-53	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.35e-60	134	416	44	316	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG5479	Psp3	1.06e-37	426	702	88	388	Uncharacterized conserved protein, contains LGFP repeats [Function unknown].
pfam00756	Esterase	4.70e-37	136	408	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
pfam08310	LGFP	2.18e-20	493	544	1	52	LGFP repeat. This 54 amino acid repeat is found in many hypothetical proteins. Several hypothetical proteins from C.glutamicum and C.efficiens along with PS1 protein contain this repeat region. The N-terminus region of PS1 contains an esterase domain which transfers corynomycolic acid. The C-terminus region consists of 4 tandem LGFP repeats. It is hypothesized that the PS1 proteins in Corynebacterium, when associated with the cell wall, may be anchored via the LGFP tandem repeats that may be important for maintaining cell wall integrity [Adindla et al. Comparative and Functional Genomics 2004; 5:2-16]. Deletion of Corynebacterium glutamicum csp1 protein results in a 10-fold increase in the cell volume of the organism and infers the corresponding proteins involvement in the cell shape formation. The secondary structure of each repeat is predicted to comprise two beta-strands and one alpha-helix [Adindla et al. 2004].
COG5479	Psp3	1.89e-14	440	659	218	444	Uncharacterized conserved protein, contains LGFP repeats [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYX82608.1	0.0	1	703	1	703
AIN82131.1	0.0	1	703	1	703
QQU97149.1	0.0	1	703	1	703
QQB83145.1	0.0	1	703	1	703
QPR31267.1	0.0	1	703	1	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SX4_AAA	8.46e-207	104	688	37	615	ChainAAA, Protein PS1 [Corynebacterium glutamicum],6SX4_BBB Chain BBB, Protein PS1 [Corynebacterium glutamicum],6SX4_CCC Chain CCC, Protein PS1 [Corynebacterium glutamicum],6SX4_DDD Chain DDD, Protein PS1 [Corynebacterium glutamicum]
6SWZ_AAA	9.90e-71	439	688	7	253	ChainAAA, Protein PS1 [Corynebacterium glutamicum]
7MYG_A	1.39e-46	164	397	29	261	ChainA, Diacylglycerol acyltransferase [Mycobacterium tuberculosis],7MYG_B Chain B, Diacylglycerol acyltransferase [Mycobacterium tuberculosis]
1DQZ_A	1.47e-46	164	397	31	263	ChainA, PROTEIN (ANTIGEN 85-C) [Mycobacterium tuberculosis],1DQZ_B Chain B, PROTEIN (ANTIGEN 85-C) [Mycobacterium tuberculosis]
1DQY_A	1.60e-46	164	397	34	266	ChainA, PROTEIN (ANTIGEN 85-C) [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C1D7	1.83e-212	104	687	80	657	Protein PS1 OS=Corynebacterium melassecola OX=41643 GN=csp1 PE=4 SV=1
P0C1D6	1.04e-211	104	687	80	657	Protein PS1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=csp1 PE=1 SV=1
O52972	5.21e-45	164	412	79	326	Diacylglycerol acyltransferase/mycolyltransferase Ag85C OS=Mycobacterium avium OX=1764 GN=fbpC PE=3 SV=1
P0A4V5	5.34e-45	164	397	79	311	Diacylglycerol acyltransferase/mycolyltransferase Ag85C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=fbpC PE=3 SV=1
P9WQN9	5.34e-45	164	397	79	311	Diacylglycerol acyltransferase/mycolyltransferase Ag85C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fbpC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000390	0.998840	0.000184	0.000213	0.000171	0.000148

TMHMM  Annotations     

start	end
21	43