CAZyme Information: MGYG000002507_00123

Basic Information

• Species: Escherichia albertii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia albertii
• CAZyme ID: MGYG000002507_00123
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000002507_1|CGC2	34013.96	5.6413

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002507	4965177	Isolate	Gambia	Africa

• Gene Location: Start: 129672; End: 130589 Strand: -

Full Sequence      

MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLNPPVDFPADAKSVRDT
MLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIMDGSAAPFVYLLLDAGI
DELNCAKKFVRIKETVRVEDGDKWAEFRPYNGFSLDFTIDFNHPAIDSSNQRYAMNFSAD
AFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYRVLNEDGLRFEDEFVRHKM
LDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEAWEYVTFQDDAELPLAFKAP
STVLA

Enzyme Prediction     

EC	3.5.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	4	276	1.3e-121	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0774	LpxC	0.0	1	302	1	300	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13186	lpxC	0.0	1	299	1	295	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
TIGR00325	lpxC	0.0	2	301	1	297	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam03331	LpxC	5.76e-178	4	277	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13188	PRK13188	3.92e-89	1	275	2	298	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QST72877.1	1.18e-224	1	305	1	305
BAT33841.1	1.18e-224	1	305	1	305
BAT37963.1	1.18e-224	1	305	1	305
QTA24503.1	1.18e-224	1	305	1	305
QST27602.1	1.18e-224	1	305	1	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MQY_A	7.16e-225	1	305	1	305	CrystalStructure of the Escherichia coli LpxC/LPC-138 complex [Escherichia coli]
4MDT_A	2.40e-223	1	305	1	305	Structureof LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_B Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_C Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli],4MDT_D Structure of LpxC bound to the reaction product UDP-(3-O-(R-3-hydroxymyristoyl))-glucosamine [Escherichia coli]
3P3G_A	1.63e-222	1	300	1	300	CrystalStructure of the Escherichia coli LpxC/LPC-009 complex [Escherichia coli IHE3034],3PS1_A Crystal structure of the Escherichia Coli LPXC/LPC-011 complex [Escherichia coli IHE3034],3PS2_A Crystal structure of the Escherichia Coli LPXC/LPC-012 complex [Escherichia coli IHE3034],3PS3_A Crystal structure of the Escherichia Coli LPXC/LPC-053 complex [Escherichia coli IHE3034],4IS9_A Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4IS9_B Crystal Structure of the Escherichia coli LpxC/L-161,240 complex [Escherichia coli IHE3034],4ISA_A Crystal Structure of the Escherichia coli LpxC/BB-78485 complex [Escherichia coli IHE3034]
3NZK_A	2.43e-213	1	305	6	310	Structureof LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor [Yersinia enterocolitica],3NZK_B Structure of LpxC from Yersinia enterocolitica Complexed with CHIR090 Inhibitor [Yersinia enterocolitica]
5N8C_A	6.71e-128	1	304	2	304	Crystalstructure of Pseudomonas aeruginosa LpxC complexed with inhibitor [Pseudomonas aeruginosa],5N8C_B Crystal structure of Pseudomonas aeruginosa LpxC complexed with inhibitor [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4ZRJ1	3.92e-224	1	305	1	305	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=lpxC PE=3 SV=1
P0A727	3.92e-224	1	305	1	305	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=lpxC PE=3 SV=1
P0A726	3.92e-224	1	305	1	305	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=lpxC PE=3 SV=1
P0A725	3.92e-224	1	305	1	305	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=lpxC PE=1 SV=1
P0A728	3.92e-224	1	305	1	305	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Shigella flexneri OX=623 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002507_00123.