CAZyme Information: MGYG000003570_00030

Basic Information

• Species: Treponema_D sp900769985
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D sp900769985
• CAZyme ID: MGYG000003570_00030
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000003570_4|CGC1	43313.41	6.4972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003570	3193382	MAG	Fiji	Oceania

• Gene Location: Start: 7042; End: 8184 Strand: +

Full Sequence      

MKNLKIYPVNEIPELHFFGRNISNAERRKFRTLFWNGSGFEVHFKGQELWALVEAGYETL
EPWVCVFLNGRINSRQMITKGLHWICLARGCDENYQSDILFMKDSQPMSDDPEHFLKIHK
LALSKGGSFEKCAGRNLKIEFIGDSITTGEGLAGAVNDMDWISSHMSFCQTYAFQTAQKL
NADFRVMSQGGYGIVSGWDNCPYKIIPPHYKNVCSVVKGQLYEKLGGNEEYDFSLWQPHF
VVVNLGTNDRGGFYMPSWKDNVSGIEYKMNLDESGKPCKKDGEKILTGIKNFLSEIRINN
PDAKIIWATGFMQIPEVMEFIYKGIEQYRIISGDKNIFTLEFESMDSEVEEDDKGSRGHP
GPKTHRLATEKLCQVIKALS

Enzyme Prediction     

No EC number prediction in MGYG000003570_00030.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	138	376	4.1e-51	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	1.51e-24	138	377	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam13472	Lipase_GDSL_2	1.27e-04	141	367	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	4.10e-04	139	372	1	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIW41337.1	1.09e-101	2	379	5	372
QYK69025.1	1.54e-101	2	379	5	372
APB74599.1	4.37e-101	2	379	5	372
ALA43608.1	4.37e-101	2	379	5	372
QYK63765.1	1.24e-100	2	379	5	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U37_A	1.69e-81	14	377	48	401	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	5.30e-80	14	377	48	401	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
2WAO_A	3.78e-23	35	377	29	328	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	9.72e-23	35	377	29	328	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
4XVH_A	1.54e-07	138	251	111	218	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	1.46e-21	35	377	510	809	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PDE5	5.24e-06	135	372	141	349	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003570_00030.