CAZyme Information: MGYG000003620_00205

Basic Information

• Species: Bulleidia massiliensis_B
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia; Bulleidia massiliensis_B
• CAZyme ID: MGYG000003620_00205
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000003620_15|CGC1	43041.37	4.9758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003620	2688357	MAG	Fiji	Oceania

• Gene Location: Start: 11059; End: 12168 Strand: -

Full Sequence      

MKKNYALDLPQIRKLGRTISVQTRNSIIFDWTDSGFEFEFDGSLLLAEIITSPYIWSESI
INDVTQQSETIKQTDWPWVIVLLDEDEKPYRKFQLNAEKEEYLLFSSNAPEHHRIRLIRL
NEAAFYRTELQILRYDGTISRSTHSYNGRIEFIGDSITCGFGIATNNYNRLFYGIDEDGW
ETYASLTARKLNYEPQMVCVSGITLSSGFQWMPYVFGMKEIYPYADWFNSFSSSKQRWDF
SSHHADIVVVNLGTNDATGIAKSDNPEEAEQKFAREYRDFLSYLREKYGSETIIICALGT
MDYYLFDHIKSISDELRADGDQRIYSFKFQKMMPDSSDVGALGHPTYIRHKKMSEELCRF
IQQIEHQLT

Enzyme Prediction     

EC	3.1.1.72	3.1.1.-	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	149	361	4.8e-54	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	1.93e-30	149	362	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam00657	Lipase_GDSL	7.02e-08	150	305	1	142	GDSL-like Lipase/Acylhydrolase.
pfam13472	Lipase_GDSL_2	3.35e-07	152	318	1	128	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
pfam17996	CE2_N	7.69e-07	16	131	3	94	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd00229	SGNH_hydrolase	5.41e-06	150	360	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL50870.1	3.86e-38	12	364	23	361
QEH70460.1	1.11e-35	86	363	63	344
ADZ84814.1	5.96e-35	74	362	54	344
QEH70287.1	5.96e-35	74	362	54	344
ACZ98663.1	6.64e-32	81	364	62	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	3.24e-28	65	357	41	323	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	8.54e-28	65	357	41	323	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
3U37_A	3.34e-09	91	362	106	401	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],3U37_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]
4DEV_A	5.84e-08	91	362	106	401	AnAcetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_B An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_C An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_D An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_E An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_F An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_G An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316],4DEV_H An Acetyl Xylan Esterase (Est2A) from the Rumen Bacterium Butyrivibrio proteoclasticus. [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	2.74e-26	65	357	522	804	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003620_00205.