CAZyme Information: MGYG000004627_00244

Basic Information

• Species: Prevotella nigrescens
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella nigrescens
• CAZyme ID: MGYG000004627_00244
• CAZy Family: GH18
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1135		129568.14	6.9878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004627	2663266	MAG	Germany	Europe

• Gene Location: Start: 16488; End: 19895 Strand: +

Full Sequence      

MDRQVFQTNSRQRWNRFKWTLRVLLTIAMLLGAVFLAMFALEGSPRMPFRHDYRSVVSAG
KPFLKDNKTSKEYKSFRDFFQEQRMHSNYARVATRQHRFVGKARGLAQKYIAEWTDPRMG
IRSAWYVNWDKRAYLSLKNNIKHLNMVLPEWFFIDPNTDQLESRIDQKALKLMHSAGVPI
LPMLTNNYGAKFRSEPIGRIMSDPKKRMALINQLADQCKQHGFVGINLDLEDLNINDNAL
LVTLVKDFATVFHAHGLYVTQAIAAFNDDYDVQELAKYDDYLFLMAYDEHNSTSQPGAVS
SQRWVEKATDWAAKNVPNDKIVLGLAAYGYDWTEGKAVGTAVSFDQIIATAQNAGAKIAF
NDDTYNLDFSYKDEGNGTLHHVFFPDAATTFNIMRFGTQYHMAGFGLWRLGTEDKRIWRF
YGKDMAWENASKLSVSKLMQLNGTDDVNFVGSGEVLNVTSEPHHGKIAVTIDKDNCLITE
EYYQALPTTYTIQRLGKCKPKQLVLTFDDGPDEHWTPTVLSTLKKYKVPAAFFMVGLQME
KNLPLVKQVFDDGHTIGNHTFTHHDMSENSDRRSYAELKLTRMLIESITGQSTILFRAPY
NADADPTGHEEIWPMIIASRRNYLFVGESIDPNDWQPGVTADQIYKRVIDGVHNEDGHII
LLHDAGGDTREATVAALPRIIETLQREGYQFISLEQYLDMSRQTLMPPIEKGNVYYAMQA
NLSLAEFIYHVSDFLTALFLVFLVLGFVRLLFMYILMVREKRTENHRNYAPISAGTAPEV
SIIVPAYNEEVNIVRTISNLKQQDYPSFHIYLVDDGSSDNTLARAREQFGNDAEVTIIEK
ENGGKASALNRGIAACTTEYVVCIDADTQLQSDAVSKLMRHFVADKTGRVGAVAGNVKVG
NQRNMLTYWQAIEYTTSQNFDRMAYSNINAITVIPGAIGAFRKKVLEEVGGFTTDTLAED
CDLTMSINERGYIIENENYAIALTEVPETLRQFVKQRIRWCFGVMQAFWKHRSSLFATSE
KGFGMWAMPNMLVFQYIIPTFSPLADVLMLIGLFTGNAAQVFIYYLVFLLVDASVSIMAY
IFEHERLWVLLWIIPQRFFYRWIMYYVLFKSYLKAIKGELQTWGVLKRTGHVKSS

Enzyme Prediction     

No EC number prediction in MGYG000004627_00244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	778	1003	8.5e-38	0.9956521739130435
GH18	137	415	2.4e-34	0.847972972972973
CE4	497	601	1.1e-28	0.7923076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10962	CE4_GT2-like	3.06e-96	501	699	1	196	Catalytic NodB homology domain of uncharacterized bacterial glycosyl transferase, group 2-like family proteins. This family includes many uncharacterized bacterial proteins containing an N-terminal GH18 (glycosyl hydrolase, family 18) domain, a middle NodB-like homology domain, and a C-terminal GT2-like (glycosyl transferase group 2) domain. Although their biological function is unknown, members in this family contain a middle NodB homology domain that is similar to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Like SpPgdA, this family is a member of the carbohydrate esterase 4 (CE4) superfamily. The presence of three domains suggests that members of this family may be multifunctional.
cd06423	CESA_like	4.09e-68	782	960	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd02874	GH18_CFLE_spore_hydrolase	5.51e-65	124	419	6	311	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG1215	BcsA	5.75e-64	727	1116	5	391	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	3.42e-59	735	1123	1	411	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB55043.1	0.0	1	1135	1	1135
QUB50645.1	0.0	1	1135	1	1135
QUB50174.1	0.0	1	1135	1	1135
AXV48412.1	0.0	1	1134	1	1134
QUB90351.1	0.0	1	1134	1	1134

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O6Y_A	9.67e-29	496	703	16	213	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]
5O6Y_B	1.13e-27	496	703	16	213	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579],5O6Y_C Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579],5O6Y_D Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]
7FBW_A	1.54e-27	487	699	101	301	ChainA, Predicted xylanase/chitin deacetylase [Caldanaerobacter subterraneus subsp. tengcongensis MB4]
4L1G_A	4.82e-27	496	703	68	265	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_B Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_C Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_D Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
2C71_A	5.55e-27	501	711	5	202	ChainA, Glycoside Hydrolase, Family 11:clostridium Cellulosome Enzyme, Dockerin Type I:polysaccharide [Acetivibrio thermocellus],2C79_A Chain A, GLYCOSIDE HYDROLASE, FAMILY 11:CLOSTRIDIUM CELLULOSOME ENZYME, DOCKERIN TYPE I:POLYSACCHARIDE [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XAR5	1.23e-33	754	1040	51	330	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
P75905	4.06e-33	754	1040	51	330	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q7A351	1.47e-32	754	1003	24	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q8GLC5	1.47e-32	780	1009	49	280	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q6GDD8	1.47e-32	754	1003	24	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
19	41
736	758
924	941
1032	1054
1061	1083
1087	1109