CAZyme Information: MGYG000001499_00032

Basic Information

• Species: Muricomes contortus_B
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes contortus_B
• CAZyme ID: MGYG000001499_00032
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		47139.88	4.2358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001499	5155658	Isolate	not provided	not provided

• Gene Location: Start: 26843; End: 28108 Strand: -

Full Sequence      

MTSLRAMQNNAVDKGQLQINVTSEITALPVTGATISISYTGVPESTLEQVNTDASGQTDV
LDLDAPPLEYSLNPTVEYQPYSEYTLDISAPGFEPMSIAGTEILPDVRAIQNVALRPNDQ
TRENEQVFVIPAHTLYGEYPPKIAEEEIKPINETGEIVLSRVVVPEFIIVHDGSPRDTTA
QNYYVKYKDYIKNVASSEIYATWPADTIRANVLAIMSFTLNRVYTEWYRNKGYDFTITSS
TAFDHKWIPERNFYDTISVIVDELFADYLSRPNVRQPILTQYCDGRRVTCPNWMTQWGSM
ALGEQGYSPIEILRYYYGDDMYINTAQEISGVPSSWPGYTLEIGSSGDKVRQMQEQLNVI
AGAYPAIPKIDADGIYGPATAATVEKFQSVFGLPQTGTVDYRTWYKISEIYVGVSRIAEL
G

Enzyme Prediction     

No EC number prediction in MGYG000001499_00032.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	4.53e-12	346	407	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	1.21e-06	340	407	38	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.42e-04	337	407	117	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	2.38e-04	294	317	237	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam13620	CarboxypepD_reg	0.004	29	115	13	81	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEI32542.1	2.92e-249	7	420	16	429
QHB25032.1	2.92e-249	7	420	16	429
QRT31086.1	1.81e-248	7	420	18	431
QRT50293.1	9.18e-248	1	420	1	418
QUO33025.1	6.97e-238	15	420	12	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1LBU_A	1.87e-07	335	410	5	76	HydrolaseMetallo (zn) Dd-peptidase [Streptomyces albus G]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00733	1.56e-06	335	410	47	118	Zinc D-Ala-D-Ala carboxypeptidase OS=Streptomyces albus G OX=1962 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001499_00032.