CAZyme Information: MGYG000001417_00521

Basic Information

• Species: Noviherbaspirillum massiliense
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Noviherbaspirillum; Noviherbaspirillum massiliense
• CAZyme ID: MGYG000001417_00521
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	MGYG000001417_1|CGC6	51003.69	6.195

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001417	4171493	Isolate	not provided	not provided

• Gene Location: Start: 531281; End: 532591 Strand: -

Full Sequence      

MVSGFIFATGIENSNPTICHGTVRMDEMEKCGHYQYWRKDFELLEELGISFLRYGLPLHR
TWLGPGRYDWSFADEAFEELYRRDIVPIVDLCHFGVPDWVGNFQNPDFPQLFSDYADAFA
RRFPWVQLYTPVNEMFICALFSGLYGWWNEQGREDLTFVTALKHLAKANVLSMQRILQAR
PDALFVQSESSEYFHAENPHAIKPAEIMNARRFLSLDLNYGRRVDSDVYEYLMDNGMTRE
EYHFFLANNLKHHCIMGNDYYMTNEHLVRADGRLKGSGEIFGYAVITHQYHDRYRMPVMH
TETNSAQGPQGDEAVKWLRKQWANVLRVRNDGVPIVGFTWYSLTDQVDWDTSLRENNGHV
NPLGLYDLGRSIRPVGEAYRQLIRDWKEVLPTQSVCLQVPIVAPSEHREEWAVRKRQQSV
RTRIVVSQVRIQIPEE

Enzyme Prediction     

No EC number prediction in MGYG000001417_00521.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	26	384	2.7e-42	0.8764568764568764

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.36e-14	31	383	55	450	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNE39009.1	5.66e-262	1	416	1	416
QJX46321.1	4.85e-261	5	422	5	422
QDA61707.1	9.98e-256	1	419	1	419
QIX62915.1	1.87e-255	1	423	1	423
QMW01550.1	2.86e-255	1	416	1	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E5J_A	1.84e-13	31	349	55	408	ChainA, Beta-glucosidase [Thermoanaerobacterium saccharolyticum JW/SL-YS485]
1OD0_A	3.41e-12	31	360	77	439	Family1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OD0_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIF_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIF_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIM_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIM_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIN_A Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1OIN_B Family 1 b-glucosidase from Thermotoga maritima [Thermotoga maritima],1UZ1_A Family 1 b-glucosidase from Thermotoga maritima in complex with isofagomine lactam [Thermotoga maritima],1UZ1_B Family 1 b-glucosidase from Thermotoga maritima in complex with isofagomine lactam [Thermotoga maritima],1W3J_A Family 1 b-glucosidase from Thermotoga maritima in complex with tetrahydrooxazine [Thermotoga maritima],1W3J_B Family 1 b-glucosidase from Thermotoga maritima in complex with tetrahydrooxazine [Thermotoga maritima],2CBU_A Beta-glucosidase from Thermotoga maritima in complex with castanospermine [Thermotoga maritima],2CBU_B Beta-glucosidase from Thermotoga maritima in complex with castanospermine [Thermotoga maritima],2CBV_A Beta-glucosidase from Thermotoga maritima in complex with calystegine B2 [Thermotoga maritima],2CBV_B Beta-glucosidase from Thermotoga maritima in complex with calystegine B2 [Thermotoga maritima],2CES_A Beta-glucosidase from Thermotoga maritima in complex with glucoimidazole [Thermotoga maritima],2CES_B Beta-glucosidase from Thermotoga maritima in complex with glucoimidazole [Thermotoga maritima],2CET_A Beta-glucosidase from Thermotoga maritima in complex with phenethyl- substituted glucoimidazole [Thermotoga maritima],2CET_B Beta-glucosidase from Thermotoga maritima in complex with phenethyl- substituted glucoimidazole [Thermotoga maritima],2J75_A Beta-glucosidase from Thermotoga maritima in complex with noeuromycin [Thermotoga maritima],2J75_B Beta-glucosidase from Thermotoga maritima in complex with noeuromycin [Thermotoga maritima],2J77_A Beta-glucosidase from Thermotoga maritima in complex with deoxynojirimycin [Thermotoga maritima],2J77_B Beta-glucosidase from Thermotoga maritima in complex with deoxynojirimycin [Thermotoga maritima],2J78_A Beta-glucosidase from Thermotoga maritima in complex with gluco- hydroximolactam [Thermotoga maritima],2J78_B Beta-glucosidase from Thermotoga maritima in complex with gluco- hydroximolactam [Thermotoga maritima],2J79_A Beta-glucosidase from Thermotoga maritima in complex with galacto- hydroximolactam [Thermotoga maritima],2J79_B Beta-glucosidase from Thermotoga maritima in complex with galacto- hydroximolactam [Thermotoga maritima],2J7B_A Beta-glucosidase from Thermotoga maritima in complex with gluco- tetrazole [Thermotoga maritima],2J7B_B Beta-glucosidase from Thermotoga maritima in complex with gluco- tetrazole [Thermotoga maritima],2J7C_A Beta-glucosidase from Thermotoga maritima in complex with phenylaminomethyl-derived glucoimidazole [Thermotoga maritima],2J7C_B Beta-glucosidase from Thermotoga maritima in complex with phenylaminomethyl-derived glucoimidazole [Thermotoga maritima],2J7D_A Beta-glucosidase from Thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole [Thermotoga maritima],2J7D_B Beta-glucosidase from Thermotoga maritima in complex with methoxycarbonyl-substituted glucoimidazole [Thermotoga maritima],2J7E_A Beta-glucosidase from Thermotoga maritima in complex with methyl acetate-substituted glucoimidazole [Thermotoga maritima],2J7E_B Beta-glucosidase from Thermotoga maritima in complex with methyl acetate-substituted glucoimidazole [Thermotoga maritima],2J7F_A Beta-glucosidase from Thermotoga maritima in complex with carboxylate- substituted glucoimidazole [Thermotoga maritima],2J7F_B Beta-glucosidase from Thermotoga maritima in complex with carboxylate- substituted glucoimidazole [Thermotoga maritima],2J7G_A Beta-glucosidase from Thermotoga maritima in complex with methyl acetic acid-substituted glucoimidazole [Thermotoga maritima],2J7G_B Beta-glucosidase from Thermotoga maritima in complex with methyl acetic acid-substituted glucoimidazole [Thermotoga maritima],2J7H_A Beta-glucosidase from Thermotoga maritima in complex with azafagomine [Thermotoga maritima],2J7H_B Beta-glucosidase from Thermotoga maritima in complex with azafagomine [Thermotoga maritima],2JAL_A Beta-glucosidase from Thermotoga maritima in complex with cyclophellitol [Thermotoga maritima],2JAL_B Beta-glucosidase from Thermotoga maritima in complex with cyclophellitol [Thermotoga maritima],2VRJ_A Beta-glucosidase from Thermotoga maritima in complex with N-octyl-5- deoxy-6-oxa-N-(thio)carbamoylcalystegine [Thermotoga maritima],2VRJ_B Beta-glucosidase from Thermotoga maritima in complex with N-octyl-5- deoxy-6-oxa-N-(thio)carbamoylcalystegine [Thermotoga maritima],2WBG_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WBG_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-castanospermine [Thermotoga maritima],2WC3_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC3_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-oxa-(+)-8-epi-castanospermine [Thermotoga maritima],2WC4_A Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_B Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_C Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],2WC4_D Structure of family 1 beta-glucosidase from Thermotoga maritima in complex with 3-imino-2-thia-(+)-castanospermine [Thermotoga maritima],5N6S_A Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_B Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_C Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6S_D Thermotoga maritima family 1 Glycoside hydrolase complexed with Carba-Cyclophellitol transition state mimic [Thermotoga maritima],5N6T_A Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic [Thermotoga maritima],5N6T_B Thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic [Thermotoga maritima],5OSS_A Beta-glucosidase from Thermotoga maritima in complex with Gluco-1H-imidazole [Thermotoga maritima MSB8],5OSS_B Beta-glucosidase from Thermotoga maritima in complex with Gluco-1H-imidazole [Thermotoga maritima MSB8]
6Z1H_A	3.26e-11	31	365	60	422	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6WGD_A	7.55e-10	34	360	65	435	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
6YN7_A	1.23e-08	31	143	57	175	ChainA, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_B Chain B, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_C Chain C, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius],6YN7_D Chain D, AHE, beta-glucosidase enzyme [Alicyclobacillus herbarius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q08638	1.76e-11	31	360	55	417	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
P42973	1.31e-08	29	351	61	435	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	2.17e-07	26	398	54	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	3.79e-07	34	352	65	426	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q3E8E5	1.95e-06	31	136	82	193	Putative myrosinase 3 OS=Arabidopsis thaliana OX=3702 GN=TGG3 PE=5 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999822	0.000225	0.000011	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001417_00521.