CAZyme Information: MGYG000003381_00081

Basic Information

• Species: Lachnoanaerobaculum sp000296385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoanaerobaculum; Lachnoanaerobaculum sp000296385
• CAZyme ID: MGYG000003381_00081
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000003381_6|CGC1	55469.98	5.21

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003381	2661892	MAG	United States	North America

• Gene Location: Start: 9271; End: 10716 Strand: -

Full Sequence      

MRMLWGGASASSQYEGGFTLFNKGMDTQDCRRYIKRTDNATTSTRLLTKADIERAKNLKD
GDFFPGRKGSEGLAHIDEDIEYLSELGIDIYRISVAWSRIFPTGEEEKPNEDALNMYGDI
LKKLKEKGIKIYLSLTHYALPLALVEKYGGWKNRKLVDLYLKYAKVIFERFGKYLDYVVP
FNEINTGFFSPFNGLGLLRDENKEGSGYDLNDIFAGLHNQFIASAKVIELGRKMLDTSFG
CMAACFCYYGYSCNPFDQLKTLQYEQVNQWFFTDVLAGGEYPYYMKKYFRDNNVKVEFLP
GDEELLRNNTADFVGFSYYQSNVCASEEMEKTAGNLVVSTKNPYLKANEWGWQIDPVGIR
ISMNKIYDRYKKPVMITENSFGYNDVLLEGNIINDDYRIEYLKDHFEQIKLAIDDGVECL
AYLLWGIIDIVSAGSLEMSKRYGVVYVDADNLGNGSYKRYKKKSFEFYKDYIEKERESVK
S

Enzyme Prediction     

No EC number prediction in MGYG000003381_00081.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	475	1.5e-113	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	1.70e-145	4	473	9	467	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	6.31e-145	3	473	8	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	7.13e-140	4	479	11	477	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	8.32e-129	4	479	9	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	7.09e-117	4	479	11	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK23259.1	3.26e-221	3	477	10	480
BBK63001.1	6.56e-221	3	477	10	480
QUN12825.1	2.02e-212	2	473	4	472
QMW73242.1	6.60e-208	2	472	6	475
QPS13501.1	6.60e-208	2	472	6	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.71e-133	4	479	13	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	2.46e-115	4	479	25	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	1.37e-109	4	472	13	472	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	7.21e-104	4	472	16	473	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	6.18e-102	4	472	12	473	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	7.22e-135	4	479	13	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	2.13e-124	4	472	9	466	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	2.39e-120	4	472	12	464	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	2.10e-113	4	472	9	455	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	1.22e-112	4	472	10	456	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003381_00081.