CAZyme Information: MGYG000003574_00038

Basic Information

• Species: CAG-110 sp900770015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900770015
• CAZyme ID: MGYG000003574_00038
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	MGYG000003574_9|CGC1	26824.3	4.6102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003574	3049750	MAG	Fiji	Oceania

• Gene Location: Start: 20; End: 730 Strand: +

Full Sequence      

MGLNMQAMMENMKYQAMENAEIFGTSQPHCFNLGGSQHSDLLTMKCHQAAKRVIKELYPD
IQVGLTLSLHDLQPVEGGEARAEETWAEEFTHYLPYIQGDDFLGVQNYTRTIVGAEEDLP
VPDGAERTQMGYEYYPQALEHVIRAVAKDFKGNLLVTENGVSCDDDSRRVNFINIATDGV
ARCIADGIPVKGYFYWSLMDNFEWQMGYRMRFGLISVNRETMERTPKESLYHLGSL

Enzyme Prediction     

No EC number prediction in MGYG000003574_00038.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	43	233	6.8e-47	0.5244755244755245

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00232	Glyco_hydro_1	1.67e-36	44	231	197	442	Glycosyl hydrolase family 1.
COG2723	BglB	8.73e-27	43	231	199	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK13511	PRK13511	1.36e-22	101	231	292	457	6-phospho-beta-galactosidase; Provisional
PLN02849	PLN02849	4.55e-11	47	231	233	474	beta-glucosidase
PLN02998	PLN02998	9.39e-10	101	236	326	484	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQD66451.1	1.40e-139	1	236	193	428
QQA37083.1	4.63e-138	1	236	193	428
AHF24559.1	6.92e-114	2	236	202	436
AXB29242.1	1.91e-110	2	235	196	429
QTE67958.1	5.58e-107	2	234	191	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	5.70e-55	44	235	216	407	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	2.24e-48	33	236	226	427	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	5.45e-30	47	231	206	439	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1QOX_A	4.33e-27	72	231	250	436	ChainA, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_B Chain B, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_C Chain C, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_D Chain D, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_E Chain E, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_F Chain F, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_G Chain G, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_H Chain H, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_I Chain I, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_J Chain J, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_K Chain K, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_L Chain L, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_M Chain M, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_N Chain N, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_O Chain O, Beta-glucosidase [Niallia circulans subsp. alkalophilus],1QOX_P Chain P, Beta-glucosidase [Niallia circulans subsp. alkalophilus]
3AHX_A	8.52e-27	38	231	195	434	Crystalstructure of beta-glucosidase A from bacterium Clostridium cellulovorans [Clostridium cellulovorans],3AHX_B Crystal structure of beta-glucosidase A from bacterium Clostridium cellulovorans [Clostridium cellulovorans],3AHX_C Crystal structure of beta-glucosidase A from bacterium Clostridium cellulovorans [Clostridium cellulovorans],3AHX_D Crystal structure of beta-glucosidase A from bacterium Clostridium cellulovorans [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03506	2.39e-26	72	231	251	437	Beta-glucosidase OS=Niallia circulans OX=1397 GN=bglA PE=1 SV=3
P22505	2.85e-24	86	229	267	435	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1
B9K7M5	1.87e-23	22	231	174	431	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P10482	2.76e-23	101	231	298	445	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P22073	4.54e-22	66	231	242	433	Beta-glucosidase A OS=Paenibacillus polymyxa OX=1406 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003574_00038.