CAZyme Information: MGYG000004285_00669

Basic Information

• Species: UMGS1670 sp900546215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; UMGS1670; UMGS1670 sp900546215
• CAZyme ID: MGYG000004285_00669
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000004285_6|CGC1	53531.68	5.6981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004285	2345577	MAG	China	Asia

• Gene Location: Start: 13213; End: 14616 Strand: -

Full Sequence      

MGFPKDFLWGGAVAANQCEGAYNEDGKGLSVQDVMPKGIRGAHTGRPTPDNLKLIGIDFY
HRYRDDIKLFAEMGFKVFRTSIAWSRIFPNGDDEIPNEAGLEFYDSLFDECLKHGIKPLV
TLSHYEPPLALAEKYDGWLDRRVIGFYEKFCKTVFERYKDKVKYWLTFNEINSLPNAPFM
SGAIMTPKDRLTEEDFYRAMHHQLVASASATRLCHEIIPDAKVGCMILGITVYPLRPHPD
DVIKTMLKDRETYQFSDIHARGRYPSYLLKYFKDKGIDPGITAEDEEILKNTVDFISFSY
YSSICESADPQGAEQTGGNLSRGYKNPYLKSSQWGWQIDPQGLRYTLNKLYDRYQLPLFI
VENGLGAEDKLVDDGMGGKTVEDDYRIEYLRRHLLEVEKAIEDGVEVIGYTSWGCIDLVS
ASTAEMRKRYGFIYVDRGDDGKGTLNRYKKKSFYWYKNVIETNGESL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	464	4.5e-149	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	3	467	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	466	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	467	4	477	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	1	467	2	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.63e-180	1	467	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR96258.1	3.53e-270	1	467	3	469
AGF57566.1	2.04e-269	1	467	3	469
BBF43945.1	1.00e-260	3	467	6	470
QUI23515.1	1.28e-253	2	467	4	468
AKN30150.1	5.00e-253	3	467	5	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IPL_A	1.21e-233	3	467	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
6WGD_A	2.09e-213	3	467	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	3.34e-171	4	467	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	9.52e-171	4	467	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	1.61e-169	3	467	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	1.64e-246	1	467	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	2.99e-215	3	467	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	5.51e-200	3	467	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	1.02e-195	3	467	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P11988	8.91e-186	3	467	4	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004285_00669.