CAZyme Information: MGYG000000539_00104

Basic Information

• Species: Oribacterium sp004554245
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium; Oribacterium sp004554245
• CAZyme ID: MGYG000000539_00104
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000000539_1|CGC1	44397.54	4.8351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000539	2303957	MAG	Fiji	Oceania

• Gene Location: Start: 128445; End: 129611 Strand: +

Full Sequence      

MDQKRHHLQGDRAATEQLLNEYIDYLMDHSDSEHPAWNLEMIRSGKSNKWNYIDGCMITG
ILELYEITGETRFLDFADRFLSGFVEEDGLIRTYDPEEYTLDNVNPAKNLFSMYDLTGKE
RYRKAIELVRSQLSTMPRTPEGNFWHKLIYPNQVWLDGIYMALPFYMEYEKRFDAQKGCQ
DICQQIANVEIRMRDPKTGLYYHGYDASRKMYWADPDTGCSPNFWLRAEGWFILGLVDVL
EIMKDLPMQAESVHLQHMLLDLAKALSKYQDPSGLWYQLIALPELEGNYLETSGTALISA
ALLKAVRLGFLPESFRATGEKAFYGIVDHRLTKNADGTPCVTGICLVAGLGGEQHRDGSV
AYYLSEPVVQNDAKGVGPLLLAYTEMLR

Enzyme Prediction     

No EC number prediction in MGYG000000539_00104.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	45	388	3.4e-108	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.33e-96	48	388	32	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.92e-91	40	388	17	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	3.64e-04	57	142	473	577	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam07944	Glyco_hydro_127	0.005	60	146	183	256	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04792	LanM-like	0.009	48	127	586	677	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35233.1	3.49e-178	12	388	3	378
AXB29657.1	3.55e-171	18	387	9	378
CBL00657.1	3.55e-171	18	387	9	378
ATP00557.1	3.88e-168	18	387	9	378
QIA43718.1	3.88e-168	18	387	9	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.68e-102	47	385	20	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.38e-74	47	386	36	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.98e-74	47	386	26	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	9.82e-14	50	327	47	321	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	9.88e-14	138	388	183	412	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.30e-73	47	386	36	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.66e-46	161	387	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.66e-46	161	387	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.39e-20	50	308	29	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000539_00104.