CAZyme Information: MGYG000002149_00018

Basic Information

• Species: Blautia sp003287895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp003287895
• CAZyme ID: MGYG000002149_00018
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000002149_1|CGC1	42973.42	5.906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002149	2886615	MAG	United States	North America

• Gene Location: Start: 16403; End: 17527 Strand: -

Full Sequence      

MEYINREEIQEKLDLVIQKLMHLGLPENEESLKEGGEHIGFFKRDFGISEWDWPQGVGLY
GILKVMKIQKKEEYKEFLYQWFQRNIEEGIPSRNINTTAPLLTLAELNELYKDKEFEALC
LEWADWLIHCIPKTREGGFQHVISANGDRQGVRLNDNQMWIDTLFMAVLFLNKMGQKYKR
QDWVEESIHQVLIHIKYLYDTNSGLFFHGWSFERMDNFGGIFWCRGNSWFTLGILEYIEM
FKGTLGTGVKTFFVDTYKAQVEALKKLQGKSGLWHTVLTDPTSYEEVSGSAGIIAGILKG
IRCGILDDSYLPCVKRGIRGILKNIDKDGTVLNVSGGTGVGNNAEYYKKILIAPMAYGQS
LVILALYEALRFNE

Enzyme Prediction     

No EC number prediction in MGYG000002149_00018.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	371	3.6e-100	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.71e-96	50	372	26	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.43e-95	50	371	33	351	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30792.1	5.15e-224	1	374	1	374
QHB24645.1	6.19e-224	1	374	6	379
QEI32150.1	6.19e-224	1	374	6	379
AXB29559.1	8.43e-221	4	374	5	375
QQQ99851.1	2.08e-215	5	370	10	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	1.29e-78	3	371	21	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	9.94e-78	3	371	20	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	2.12e-71	47	371	43	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4CE7_A	5.59e-16	160	331	154	333	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.09e-55	42	374	23	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	3.21e-15	160	331	161	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002149_00018.