CAZyme Information: MGYG000000760_00294

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000000760_00294
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	MGYG000000760_1|CGC3	57983.61	7.8159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000760	2818339	MAG	Bangladesh	Asia

• Gene Location: Start: 303343; End: 304878 Strand: +

Full Sequence      

MKHLNTMIATIALGLLMVLPDSMSAQFNWKYNIENGKIVTEVPQRPAGQQSALLMRTPKI
KTVRVAFVGLGARGTFAVERWTHIPGIQVMALCDYVKEKAENCQNFLKKASMPAADVYFG
EYGYKELCKRKDIDLVYIATDWIHHFPVAKCAMENGKHVAIEVPSAMNLHEIWQLIDMSE
KYRLHCVMLENCCYDFFELNSLNMAQKGLFGEVIYAQGAYRHYLFSYWDQYWKKDKSNKL
GWRLDYNMKYRGDVYPTHGLGPIAQVMNIHRGDRMKTLVAMDTKSFNGKKNVEQISGEPC
SKFANGDHTTTLISTEKGKIIEIHHNVMTSQPYNRMYQLTGTEGFANKYPIEGYALSSKN
MRQGGVIPSSDDLTAHEYLSKEDKEAVEKVYTNPIVTKYGKVAKEVGGHGGMDFIMDSRL
VYCLQNGLPMDIDVYDLAEWCCLAELGAIAMDNGNLPVEVPDFTRGSWNTIKGYSHAFAT
PEDEAANEAQAKAFTAKLKEKGKRYWEKKDK

Enzyme Prediction     

No EC number prediction in MGYG000000760_00294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	59	470	4.4e-150	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.99e-18	61	354	2	265	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.78e-10	63	181	1	111	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	2.10e-06	62	215	4	147	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI55632.1	1.07e-293	5	511	5	510
QUB82610.1	1.07e-293	5	511	5	510
QUB79140.1	1.07e-293	5	511	5	510
QUB43953.1	3.94e-292	17	511	1	495
QUB39974.1	7.16e-292	18	511	17	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.50e-82	37	470	17	440	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.00e-61	61	483	19	443	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	5.31e-08	62	213	7	148	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3F4L_A	6.18e-06	126	425	59	327	Crystalstructure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_B Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_C Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_D Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_E Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_F Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	8.76e-253	1	508	1	513	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	1.06e-245	29	506	35	510	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	5.21e-213	2	500	5	499	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	1.30e-193	4	479	6	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	5.67e-191	2	479	3	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000378	0.998854	0.000181	0.000226	0.000187	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000760_00294.