CAZyme Information: MGYG000003057_00182

Basic Information

• Species: CAG-110 sp900554625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900554625
• CAZyme ID: MGYG000003057_00182
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000003057_9|CGC1	45344.27	4.8704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003057	2131833	MAG	United States	North America

• Gene Location: Start: 4390; End: 5592 Strand: -

Full Sequence      

MEQIRVGIIGLGLRGYGLTNQVFLKMDDIRITAVCDIYQDRVERVADLIENAGHKRPYET
TDYKKLVNKNLVDCVIVITSWKYHTEVVTYCMEQGIPVGSEVGGAYTVEECYQLVRTQER
TGTPYMFLENCNYGQRELMVLNMVRMGLFGQIVHCSGGYCHDLREEITTGKENRHYRLNE
YLSRNCENYPSHEMGPIMKILDINHSNQLMTLSSTASKSVGLHEYCLKHQPENEELCEAK
FAQGDIVTTVITCAGGETITITLDTTLPRPYSRGFTVRGTKGMYTEVNDSVFIDGTHNDC
DFEWKEQWGNADQYAKEYNHPIWASITEEERAAGHGGMDYLCYRDFFDHIRSGEPMPIDV
YDAATIMCITPLSEISIASGGMPVKIPNFKEKTAEANANE

Enzyme Prediction     

No EC number prediction in MGYG000003057_00182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	390	2.3e-142	0.974937343358396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.43e-15	1	367	1	322	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.60e-10	4	126	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	9.28e-162	1	389	1	390
QJD87109.1	8.73e-160	2	389	3	389
QTH41319.1	3.18e-159	2	389	6	392
QTH43530.1	1.39e-156	2	389	3	390
QNK55026.1	2.70e-156	2	389	3	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	2.39e-90	2	389	19	426	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	3.50e-64	1	389	40	433	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	4.97e-92	2	389	32	436	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8F7	1.31e-89	2	389	19	426	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A6LB54	1.94e-88	3	389	49	452	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	3.58e-86	3	389	52	454	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
Q01S58	5.51e-77	4	389	43	427	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003057_00182.