CAZyme Information: MGYG000002246_00035

Basic Information

• Species: UBA6857 sp900555805
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA6857; UBA6857 sp900555805
• CAZyme ID: MGYG000002246_00035
• CAZy Family: GH129
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	MGYG000002246_3|CGC1	71720.18	7.7193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002246	1721573	MAG	Peru	South America

• Gene Location: Start: 5027; End: 6931 Strand: +

Full Sequence      

MLKVQQHNVTLSLDERTLSFRITADGFTWISQGRKPYLTLRKKAGKKYIKMRQLLTSAKK
KEFSADGGKITARLGGFSFLGERPFTLVCSTEITAESRVVFSVKAENETDMSVASVYFPG
AFNAEKYSEGYAVEPVRQGFIMPDGYKKNYIGKRLLFILEREINTGDWYHPFYGRVCDRH
GYSAILETPFDAKAVSQKGRNNSLLTGVNWSSSLGKVSYERRVRFDLFSNGDYNSVAKNF
RAYLKETGQFVSITDKIARNPNVSYLVGAPVLHHRIYTHIQPKSDFYKKHGQNIILYATF
EQRARELEHIKSLGLDRLYIHTDGWGIEGYDNQHPYVLPPNEQAGGWDGMKKLADKCLEI
GYCFGIHDQYRDFYYDCKHYDEDLAVMNIDGSHPYCDIWDGGAHSWLCSTQALGFVERTY
NELKAHGVHIGGSYLDVFGVVSGDECFNPKHRVTREESIQARGKCFDFLTDNGIIPSSEE
GASQLMDKLALVHHAPYQVTPQGGGKAVGIPVPLTSLVYHDCVFVPWVSGGKNGWGIPNT
DNSKLHCALNAGTPYFYPHKYIEKPKAHEELVDDKKLKAEIENAKELAAIQAKLYDKEMV
RHEFVGGNLRVQKAYYSDGTVITVDFDKDVYTVE

Enzyme Prediction     

No EC number prediction in MGYG000002246_00035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH129	5	634	4.8e-119	0.948220064724919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14244	GH_101_like	6.01e-38	286	482	3	211	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam18952	DUF5696	1.29e-08	220	634	195	599	Family of unknown function (DUF5696). This is a family of unknown function with some overlap with clan family members of CL0058.
pfam12905	Glyco_hydro_101	2.56e-08	256	439	9	178	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK55038.1	5.11e-130	13	634	19	625
QUH27660.1	4.23e-129	8	633	13	626
QTH41330.1	1.45e-128	94	634	105	625
QUH27706.1	5.71e-128	4	633	8	621
QJD87097.1	1.40e-125	4	633	12	625

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WZN_A	2.10e-108	1	633	1	628	Alpha-N-acetylgalactosaminidaseNagBb from Bifidobacterium bifidum - GalNAc complex [Bifidobacterium bifidum],5WZN_B Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - GalNAc complex [Bifidobacterium bifidum],5WZP_A Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - ligand free [Bifidobacterium bifidum],5WZP_B Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - ligand free [Bifidobacterium bifidum],5WZR_A Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - Gal-NHAc-DNJ complex [Bifidobacterium bifidum],5WZR_B Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - Gal-NHAc-DNJ complex [Bifidobacterium bifidum]
5WZQ_A	8.63e-103	1	633	1	628	Alpha-N-acetylgalactosaminidaseNagBb from Bifidobacterium bifidum - quadruple mutant [Bifidobacterium bifidum],5WZQ_B Alpha-N-acetylgalactosaminidase NagBb from Bifidobacterium bifidum - quadruple mutant [Bifidobacterium bifidum]
5OPQ_A	1.99e-12	190	634	260	662	A3,6-anhydro-D-galactosidase produced by Zobellia galactanivorans. This is an exo-lytic enzyme that hydrolyzes terminal 3,6-anhydro-D-galactose from the non-reducing end of carrageenan oligosaccharides. [Zobellia galactanivorans],5OPQ_B A 3,6-anhydro-D-galactosidase produced by Zobellia galactanivorans. This is an exo-lytic enzyme that hydrolyzes terminal 3,6-anhydro-D-galactose from the non-reducing end of carrageenan oligosaccharides. [Zobellia galactanivorans],5OPQ_C A 3,6-anhydro-D-galactosidase produced by Zobellia galactanivorans. This is an exo-lytic enzyme that hydrolyzes terminal 3,6-anhydro-D-galactose from the non-reducing end of carrageenan oligosaccharides. [Zobellia galactanivorans],5OPQ_D A 3,6-anhydro-D-galactosidase produced by Zobellia galactanivorans. This is an exo-lytic enzyme that hydrolyzes terminal 3,6-anhydro-D-galactose from the non-reducing end of carrageenan oligosaccharides. [Zobellia galactanivorans]
6QEP_A	7.81e-07	324	487	342	497	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6QEV_B	7.81e-07	324	487	342	497	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002246_00035.