CAZyme Information: MGYG000001355_00960

Basic Information

• Species: Anaerococcus hydrogenalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus hydrogenalis
• CAZyme ID: MGYG000001355_00960
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		47977.63	5.1183

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001355	1889362	Isolate	not provided	not provided

• Gene Location: Start: 13642; End: 14853 Strand: -

Full Sequence      

MDTFIQYLKNNNFTHLNFMPIFSNRIEGSLGFSPSSFYALNENFTSIDNFKSFIDLCHKN
NIGIILDFDIGEFDPFNKGLIKFDGSNMYNYDYDDILYNYQGSVNMDPKKDIVKSFIFSL
ISYWIDEYNIDGIKFANLENMVFWQGDKSRGNNEYWLALLKEINFYIKSLGKISIGSFYY
IWKNEFDEDLGFSYIYDRTFSSLIKIMQKYPYQRDNYSNIVENIIRGKYDEYILGFDFSD
SLSEGASLCMKMYSDNKKYQQLKTLFLLLYSLSSQKMIFMEDEIGSLKSFDINRKVDFNK
INKEEKDFNEFYKGLSKFYQDHKNLYKKDTQTKILEIEGYSLYAFIREYKKEKYLVLINL
TDLDYKIDLDFKFEKILTSFEGKYKEDDKIKIPAFGSGIFRIK

Enzyme Prediction     

No EC number prediction in MGYG000001355_00960.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	7	285	4.7e-42	0.9900332225913622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11322	AmyAc_Glg_BE	6.40e-100	1	321	61	402	Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme). The glycogen branching enzyme catalyzes the third step of glycogen biosynthesis by the cleavage of an alpha-(1,4)-glucosidic linkage and the formation a new alpha-(1,6)-branch by subsequent transfer of cleaved oligosaccharide. They are part of a group called branching enzymes which catalyze the formation of alpha-1,6 branch points in either glycogen or starch. This group includes proteins from bacteria, eukaryotes, and archaea. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK12313	PRK12313	1.29e-32	5	403	177	628	1,4-alpha-glucan branching protein GlgB.
PRK05402	PRK05402	7.95e-22	2	164	269	442	1,4-alpha-glucan branching protein GlgB.
PRK12568	PRK12568	2.35e-21	2	347	273	644	glycogen branching enzyme; Provisional
COG0296	GlgB	3.15e-20	2	156	168	321	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN55949.1	3.92e-175	1	403	144	546
QQB61276.1	7.87e-175	1	403	144	546
ACV28816.1	1.30e-107	2	403	144	551
CBL17307.1	4.08e-47	5	365	115	490
SQH56751.1	3.41e-42	5	379	173	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	3.45e-28	2	331	319	669	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
6KLF_A	1.09e-27	2	331	295	645	ChainA, 1,4-alpha-glucan branching enzyme GlgB [Crocosphaera subtropica ATCC 51142]
5GR5_A	3.71e-27	2	331	319	669	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR3_A	5.00e-27	2	331	319	669	Crystalstructure of branching enzyme L541A/W655A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR2_A	5.00e-27	2	331	319	669	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XK15	3.38e-35	2	403	207	664	1,4-alpha-glucan branching enzyme GlgB 2 OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgB2 PE=3 SV=1
Q8DT52	5.09e-35	2	403	169	623	1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=glgB PE=3 SV=1
Q8E5V8	3.16e-34	2	403	165	617	1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=glgB PE=3 SV=1
Q8E081	4.30e-34	2	403	165	617	1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) OX=208435 GN=glgB PE=3 SV=1
Q3K1K5	4.30e-34	2	403	165	617	1,4-alpha-glucan branching enzyme GlgB OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001355_00960.