CAZyme Information: MGYG000003189_00287

Basic Information

• Species: Haemophilus_D parainfluenzae_M
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_M
• CAZyme ID: MGYG000003189_00287
• CAZy Family: GH13
• CAZyme Description: Glycogen debranching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		74771.64	5.1193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003189	2132219	MAG	United States	North America

• Gene Location: Start: 37605; End: 39581 Strand: -

Full Sequence      

MFTIYNNGKPAPMGYSIFTENGVKVTNFALFSAAASGVELCLFDGDKETRFPMVCTNNVW
HLAVAGVTVGTEYGFCIHGEHANPNKLMLDPYAKAVNGKPDLTTKESRSWFLMNDHRDNA
HIAPRAEIISENFDWENETAPNTPWAETIVYELHVKGFSQLNDKIPAELRGTYAGLSHPI
NLAYLKELGVTAVELLPVNFHINEPHLQARGLQNYWGYNPLAMFAVEPKYAATNNPLAEF
KAMVKAFHKAGIEVILDVVFNHSAESEQTYPTFCQRGIDDQTYYWRNDQGRYINWTGCGN
MLNLSSDVGRKWVVDCLRYWAEQCHVDGFRFDLASVLGRDTPDFNTQAQLFTDIKNEPSL
QNIKLIAEPWDIGHYGYQVGNFPNYFAEWNDRFRDDLCRFWLWKSGEIGAFAERFAGSSD
LFKKNDRLPHTTLNFITAHDGFVMQDLVSYNQKHNEANGEENRDGHNENYSYNHGVEGST
ESLSEPQKSAVENNRTFAQSGLLMSLLLANGTPMLLAGDEFGNTQYGNNNAYCQDNEITW
LKWANFNKELFELTKQTIAARKQIGSLNRNQWWSGDNVQWLNIHGNQMTVDDWQNQQTKA
LQVVLDKHCLLLINAKAEGQVFHLPDEKWKPQIGTHNLILDAQQAELSSMGFCMLSDE

Enzyme Prediction     

EC	3.2.1.68	3.2.1.-	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	170	524	1.1e-151	0.9971509971509972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02100	glgX_debranch	0.0	7	655	1	686	glycogen debranching enzyme GlgX. This family consists of the GlgX protein from the E. coli glycogen operon and probable equivalogs from other prokaryotic species. GlgX is not required for glycogen biosynthesis, but instead acts as a debranching enzyme for glycogen catabolism. This model distinguishes GlgX from pullanases and other related proteins that also operate on alpha-1,6-glycosidic linkages. In the wide band between the trusted and noise cutoffs are functionally similar enzymes, mostly from plants, that act similarly but usually are termed isoamylase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK03705	PRK03705	0.0	3	629	2	627	glycogen debranching protein GlgX.
COG1523	PulA	0.0	1	658	8	692	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
cd11326	AmyAc_Glg_debranch	0.0	133	564	1	433	Alpha amylase catalytic domain found in glycogen debranching enzymes. Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities: 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. In Escherichia coli, GlgX is the debranching enzyme and malQ is the 4-alpha-glucanotransferase. TreX, an archaeal glycogen-debranching enzyme has dual activities like mammals and yeast, but is structurally similar to GlgX. TreX exists in two oligomeric states, a dimer and tetramer. Isoamylase (EC 3.2.1.68) is one of the starch-debranching enzymes that catalyzes the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen and their beta-limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK14510	PRK14510	4.06e-174	6	625	9	647	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM60613.1	0.0	1	658	1	658
SQH97620.1	0.0	1	658	1	658
BBF07429.1	0.0	1	658	1	659
AXP38315.1	0.0	1	658	1	659
AYO34933.1	0.0	1	658	1	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WSK_A	4.63e-217	8	642	7	643	Crystalstructure of Glycogen Debranching Enzyme GlgX from Escherichia coli K-12 [Escherichia coli K-12]
2VNC_A	9.88e-154	8	636	15	686	Crystalstructure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VNC_B Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VR5_A Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VR5_B Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VUY_A Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],2VUY_B Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],7EAV_A Chain A, Glycogen debranching enzyme [Saccharolobus solfataricus],7EAV_B Chain B, Glycogen debranching enzyme [Saccharolobus solfataricus]
4J7R_A	4.87e-108	8	593	60	732	CrystalStructure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4J7R_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4OKD_A Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii],4OKD_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii]
1BF2_A	2.28e-87	70	606	95	671	StructureOf Pseudomonas Isoamylase [Pseudomonas amyloderamosa]
2E8Y_A	3.58e-40	26	562	115	614	Crystalstructure of pullulanase type I from Bacillus subtilis str. 168 [Bacillus subtilis],2E8Y_B Crystal structure of pullulanase type I from Bacillus subtilis str. 168 [Bacillus subtilis],2E8Z_A Crystal structure of pullulanase type I from Bacillus subtilis str. 168 complexed with alpha-cyclodextrin [Bacillus subtilis],2E8Z_B Crystal structure of pullulanase type I from Bacillus subtilis str. 168 complexed with alpha-cyclodextrin [Bacillus subtilis],2E9B_A Crystal structure of pullulanase type I from Bacillus subtilis str. 168 complexed with maltose [Bacillus subtilis],2E9B_B Crystal structure of pullulanase type I from Bacillus subtilis str. 168 complexed with maltose [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45178	0.0	1	658	1	659	Glycogen operon protein GlgX homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=glgX PE=3 SV=1
B5F8Q3	1.62e-217	8	642	7	643	Glycogen debranching enzyme OS=Salmonella agona (strain SL483) OX=454166 GN=glgX PE=3 SV=1
B4TY88	1.62e-217	8	642	7	643	Glycogen debranching enzyme OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=glgX PE=3 SV=1
Q5PM07	2.29e-217	8	642	7	643	Glycogen debranching enzyme OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=glgX PE=3 SV=1
B5BHI1	2.29e-217	8	642	7	643	Glycogen debranching enzyme OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=glgX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999899	0.000109	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003189_00287.